Overview

  • Product name

  • Description

    Rabbit polyclonal to FDFT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human FDFT1 aa 2-417.
    Sequence:

    EFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTS RSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFH SFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMG IGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDT ERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPEN IDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLA ACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPD SDPSSSKTRQIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYL TTLSQVTEDYVQTGEH


    Database link: P37268

  • Positive control

    • WB: HepG2, SH-SY5Y and HEK-293 cell lysate. IHC-P: Human adrenal gland tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 48 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Pathway

    Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 1/3.
  • Sequence similarities

    Belongs to the phytoene/squalene synthase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DGPT antibody
    • ERG9 antibody
    • Farnesyl diphosphate farnesyltransferase antibody
    • Farnesyl-diphosphate farnesyltransferase antibody
    • FDFT_HUMAN antibody
    • FDFT1 antibody
    • FPP:FPP farnesyltransferase antibody
    • SQS antibody
    • Squalene synthase antibody
    • Squalene synthetase antibody
    • SS antibody
    see all

Images

  • All lanes : Anti-FDFT1 antibody (ab236675) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : SH-SY5Y (human neuroblastoma cell line from bone marrow) cell lysate
    Lane 3 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 48 kDa

  • Paraffin-embedded human adrenal gland tissue stained for FDFT1 using ab236675 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling FDFT1 using ab236675 at 1/100 dilution in ICC/IF. Secondary antibody was Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

References

ab236675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up