Overview

  • Product name

    Anti-FDPS/FPS antibody - C-terminal
    See all FDPS/FPS primary antibodies
  • Description

    Rabbit polyclonal to FDPS/FPS - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human FDPS/FPS aa 120-419 (C terminal).
    Sequence:

    IGGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVAD DIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYY LNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAF YSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPS VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKA LYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK


    Database link: P14324

  • Positive control

    • 293T, HepG2, MCF7, U-251MG, BxPC3, Mouse liver and Mouse ovary extracts.
  • General notes

    Previously labelled as FDPS. 

Properties

Applications

Our Abpromise guarantee covers the use of ab189874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 48 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Key enzyme in isoprenoid biosynthesis which catalyzes the formation of farnesyl diphosphate (FPP), a precursor for several classes of essential metabolites including sterols, dolichols, carotenoids, and ubiquinones. FPP also serves as substrate for protein farnesylation and geranylgeranylation. Catalyzes the sequential condensation of isopentenyl pyrophosphate with the allylic pyrophosphates, dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate.
  • Pathway

    Isoprenoid biosynthesis; farnesyl diphosphate biosynthesis; farnesyl diphosphate from geranyl diphosphate and isopentenyl diphosphate: step 1/1.
    Isoprenoid biosynthesis; geranyl diphosphate biosynthesis; geranyl diphosphate from dimethylallyl diphosphate and isopentenyl diphosphate: step 1/1.
  • Sequence similarities

    Belongs to the FPP/GGPP synthase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • (2E antibody
    • (2E,6E) farnesyl diphosphate synthase antibody
    • 6E)-farnesyl diphosphate synthase antibody
    • Dimethylallyltranstransferase antibody
    • Farnesyl diphosphate synthase antibody
    • Farnesyl diphosphate synthetase antibody
    • Farnesyl pyrophosphate synthase antibody
    • Farnesyl pyrophosphate synthetase antibody
    • Fdps antibody
    • FPP synthase antibody
    • FPP synthetase antibody
    • FPPS antibody
    • FPPS_HUMAN antibody
    • FPS antibody
    • Geranyltranstransferase antibody
    see all

Images

  • All lanes : Anti-FDPS/FPS antibody - C-terminal (ab189874) at 1/500 dilution

    Lane 1 : 293T cell line extract
    Lane 2 : HepG2 cell line extract
    Lane 3 : HeLa cell line extract
    Lane 4 : MCF7 cell line extract
    Lane 5 : U-251MG cell line extract
    Lane 6 : BxPC3 cell line extract
    Lane 7 : Mouse liver extract
    Lane 8 : Mouse ovary extract

    Predicted band size: 48 kDa

References

This product has been referenced in:

  • Kim YS  et al. Emodin Sensitizes Hepatocellular Carcinoma Cells to the Anti-Cancer Effect of Sorafenib through Suppression of Cholesterol Metabolism. Int J Mol Sci 19:N/A (2018). Read more (PubMed: 30321984) »
  • Kühl I  et al. Transcriptomic and proteomic landscape of mitochondrial dysfunction reveals secondary coenzyme Q deficiency in mammals. Elife 6:N/A (2017). Read more (PubMed: 29132502) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up