Overview

  • Product name

  • Description

    Rabbit polyclonal to FE65
  • Host species

    Rabbit
  • Specificity

    This antibody detects endogenous levels of FE65 protein.
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human FE65 aa 1-710.
    Sequence:

    MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDL RSAMGEGGGPEPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEAS QEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIISTQEQGPDEGE EKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPR EHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFE TDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL TWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEP LPQEEEKLPPRNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQ LSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQALLHAQPIISI RVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICS KIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGN VPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAV LGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAV QAACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSL KPKRLGAHTP


    Database link: O00213

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab192533 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 77 kDa.

Target

  • Function

    Transcription coregulator that can have both coactivator and corepressor functions. Adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain. Plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. May act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity. Function in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Associates with chromatin in a region surrounding the CASP4 transcriptional start site(s).
  • Tissue specificity

    Highly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease.
  • Sequence similarities

    Contains 2 PID domains.
    Contains 1 WW domain.
  • Post-translational
    modifications

    Phosphorylated following nuclear translocation. Phosphorylation at Tyr-546 enhances the transcription activation activity and reduces the affinity with RASD1/DEXRAS1.
  • Cellular localization

    Cell membrane. Cytoplasm. Nucleus. Cell projection > growth cone. Colocalizes with TSHZ3 in axonal growth cone (By similarity). In normal conditions, it mainly localizes to the cytoplasm, while a small fraction is tethered to the cell membrane via its interaction with APP. Following exposure to DNA damaging agents, it is released from cell membrane and translocates to the nucleus. Nuclear translocation is under the regulation of APP. Colocalizes with TSHZ3 in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adaptor protein FE65a2 antibody
    • Amyloid beta (A4) precursor protein binding family B member 1 antibody
    • Amyloid beta A4 precursor protein binding family B antibody
    • Amyloid beta A4 precursor protein binding family B member 1 antibody
    • Amyloid beta A4 precursor protein-binding family B member 1 antibody
    • Amyloid beta precursor protein binding family B member 1 antibody
    • APBB 1 antibody
    • APBB1 antibody
    • APBB1_HUMAN antibody
    • FE 65 antibody
    • Fe65 protein antibody
    • Protein Fe65 antibody
    • RIR antibody
    • stat like protein antibody
    see all

References

ab192533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up