Overview

  • Product name

    Anti-FECH antibody - N-terminal
    See all FECH primary antibodies
  • Description

    Rabbit polyclonal to FECH - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human FECH (N terminal) conjugated to keyhole limpet haemocyanin. Epitope: aa104-134.
    Sequence:

    QNKLAPFIAKRRTPKIQEQYRRIGGGSPIKI


    Database link: P22830

  • Positive control

    • NCI-H460 cell line lysates; Human kidney tissue; 293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab219349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 48 kDa.
IHC-P Use a concentration of 2.5 µg/ml.
Flow Cyt 1/10 - 1/50.

Target

  • Function

    Catalyzes the ferrous insertion into protoporphyrin IX.
  • Pathway

    Porphyrin metabolism; protoheme biosynthesis; protoheme from protoporphyrin-IX: step 1/1.
  • Involvement in disease

    Erythropoietic protoporphyria (EPP) [MIM:177000]: A form of porphyria. Porphyrias are inherited defects in the biosynthesis of heme, resulting in the accumulation and increased excretion of porphyrins or porphyrin precursors. They are classified as erythropoietic or hepatic, depending on whether the enzyme deficiency occurs in red blood cells or in the liver. Erythropoietic protoporphyria is marked by excessive protoporphyrin in erythrocytes, plasma, liver and feces, and by widely varying photosensitive skin changes ranging from a burning or pruritic sensation to erythema, edema and wheals. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the ferrochelatase family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EPP antibody
    • FCE antibody
    • Fch antibody
    • Fcl antibody
    • fech antibody
    • Ferrochelatase (protoporphyria) antibody
    • Ferrochelatase antibody
    • Ferrochelatase mitochondrial antibody
    • Heme synthase antibody
    • Heme synthetase antibody
    • HEMH_HUMAN antibody
    • mitochondrial antibody
    • Protoheme ferro lyase antibody
    • Protoheme ferro-lyase antibody
    • Protoporphyria antibody
    see all

Images

  • Anti-FECH antibody - N-terminal (ab219349) at 1/1000 dilution + NCI-H460 cell line lysate at 35 µg

    Predicted band size: 48 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue labeling FECH with ab219349 at 2.5 μg/ml dilution.

  • Flow cytometric analysis of 293 cells labeling FECH with ab219349 at 1/10 dilution (right histogram) compared to a negative control cell (left histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

References

ab219349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up