Overview

  • Product name

  • Description

    Rabbit polyclonal to FENS1/WDFY1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Mouse FENS1/WDFY1 aa 42-91 (N terminal).
    Sequence:

    ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA


    Database link: NP_081333

  • Positive control

    • Mouse heart lysate, Human kidney lysate
  • General notes

     This product was previously labelled as FENS1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab125329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml.

Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Sequence similarities

    Contains 1 FYVE-type zinc finger.
    Contains 7 WD repeats.
  • Domain

    The FYVE-type zinc finger domain mediates interactions with phosphatidylinositol 3-phosphate in membranes of early endosomes and penetrates bilayers. The FYVE domain insertion into PtdIns(3)P-enriched membranes is substantially increased in acidic conditions.
  • Cellular localization

    Early endosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • FENS 1 antibody
    • FENS-1 antibody
    • FENS1 antibody
    • KIAA1435 antibody
    • Phosphoinositide binding protein 1 antibody
    • Phosphoinositide binding protein SR1 antibody
    • Phosphoinositide-binding protein 1 antibody
    • WD repeat and FYVE domain containing 1 antibody
    • WD repeat and FYVE domain-containing protein 1 antibody
    • WD40 and FYVE domain containing protein 1 antibody
    • WD40- and FYVE domain-containing protein 1 antibody
    • WDF1 antibody
    • WDFY1 antibody
    • WDFY1_HUMAN antibody
    • ZFYVE17 antibody
    • Zinc finger FYVE domain containing protein 17 antibody
    • Zinc finger FYVE domain-containing protein 17 antibody
    see all

Images

  • Formalin fixed paraffin embedded human prostate tissue staining FENS1/WDFY1 with ab125329 at 10 ug/ml

  • Anti-FENS1/WDFY1 antibody (ab125329) at 1 µg/ml + Human Kidney
  • Formalin fixed paraffin embedded human testis tissue staining FENS1/WDFY1 with ab125329 at 10 ug/ml

  • Anti-FENS1/WDFY1 antibody (ab125329) at 1 µg/ml + Mouse heart lysate at 10 µg


    Gel concentration: 12%

    observed band at 21kDa possible isoform corresponding to Q9DAD3

References

ab125329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab125329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up