Overview

  • Product name

    Anti-Ferredoxin Reductase antibody
    See all Ferredoxin Reductase primary antibodies
  • Description

    Rabbit polyclonal to Ferredoxin Reductase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Ferredoxin Reductase aa 1-134.
    Sequence:

    MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAG FYTAQHLLKHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQ TAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYG


    Database link: P22570

  • Positive control

    • Human ovary tissue. RT-4, U-251 MG, Human plasma, Human liver and Human tonsil lysate. U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Serves as the first electron transfer protein in all the mitochondrial P450 systems. Including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver.
  • Pathway

    Steroid metabolism; cholesterol metabolism.
  • Sequence similarities

    Belongs to the ferredoxin--NADP reductase type 1 family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adrenodoxin reductase antibody
    • ADRO_HUMAN antibody
    • ADXR antibody
    • AR antibody
    • FDXR antibody
    • Ferredoxin NADP(+) reductase antibody
    • Ferredoxin reductase antibody
    • Ferredoxin--NADP(+) reductase antibody
    • mitochondrial antibody
    • NADPH adrenodoxin oxidoreductase mitochondrial antibody
    • NADPH:adrenodoxin oxidoreductase antibody
    see all

Images

  • Immunofluorescent analysis of U-2 OS cells (PFA-fixed/Triton X-100 permeabilized)labeling Ferredoxin Reductase with ab204310 at 4 µg/mL.

  • Immunohistochemical analysis of paraffin-embedded Human ovary tissue labeling Ferredoxin Reductase with ab204310 at 1/50 dilution.

References

This product has been referenced in:

  • Peng Y  et al. Biallelic mutations in the ferredoxin reductase gene cause novel mitochondriopathy with optic atrophy. Hum Mol Genet N/A:N/A (2018). Read more (PubMed: 29554255) »
  • Peng Y  et al. Biallelic mutations in the ferredoxin reductase gene cause novel mitochondriopathy with optic atrophy. Hum Mol Genet 26:4937-4950 (2017). Read more (PubMed: 29040572) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204310.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up