Overview

  • Product name

    Anti-Ferritin Heavy Chain antibody
    See all Ferritin Heavy Chain primary antibodies
  • Description

    Rabbit polyclonal to Ferritin Heavy Chain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Sheep
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Sheep Ferritin Heavy Chain aa 1-171. Expressed in E. coli. N-terminal tag.
    Sequence:

    MTTASPSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALK NFAKYFLHQSHEEREHAERLMKLQNQRGARIFLQDIKKPDRDDWENGLNA MECALCLERSVNQSLLELHKLATEKNDPHLCDFIETHYLNEQVEAIKELG DHITNLRKMGALWIGHGRVPL


    Database link: P18685

  • Positive control

    • WB: Recombinant sheep Ferritin Heavy Chain protein; Sheep cerebrum, kidney and liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Information by UniProt
  • Alternative names

    • Apoferritin antibody
    • Cell proliferation inducing gene 15 protein antibody
    • Cell proliferation-inducing gene 15 protein antibody
    • F HC antibody
    • Ferritin H subunit antibody
    • Ferritin heavy chain antibody
    • Ferritin heavy polypeptide 1 antibody
    • FHC antibody
    • FRIH antibody
    • FRIH_HUMAN antibody
    • FTH 1 antibody
    • FTH antibody
    • FTH1 antibody
    • FTH1 protein antibody
    • FTHL 6 antibody
    • FTHL6 antibody
    • Iron overload autosomal dominant antibody
    • MGC104426 antibody
    • N-terminally processed antibody
    • OK/SW-cl.84 antibody
    • PIG 15 antibody
    • PIG15 antibody
    • Placenta immunoregulatory factor antibody
    • PLIF antibody
    • Proliferation inducing gene 15 protein antibody
    • Proliferation inducing protein 15 antibody
    see all

Images

  • All lanes : Anti-Ferritin Heavy Chain antibody (ab231210) at 2 µg/ml

    Lane 1 : Sheep liver tissue lysate
    Lane 2 : Sheep cerebrum tissue lysate
    Lane 3 : Sheep kidney tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 20 kDa

  • Anti-Ferritin Heavy Chain antibody (ab231210) at 2 µg/ml + Recombinant sheep Ferritin Heavy Chain protein

    Predicted band size: 20 kDa

References

ab231210 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231210.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up