Overview

  • Product name

    Anti-Ferritin Heavy Chain antibody - C-terminal
    See all Ferritin Heavy Chain primary antibodies
  • Description

    Rabbit polyclonal to Ferritin Heavy Chain - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Chicken, Cat, Dog, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human Ferritin Heavy Chain aa 154-183 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). NCBI Accession No. NP_002023.2.
    Sequence:

    TNLRKMGAPESGLAEYLFDKHTLGDSDNES


    Database link: P02794

  • Positive control

    • Human liver tissue; HepG2 cells; A2058 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab194947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.
WB 1/1000. Predicted molecular weight: 21 kDa.
Flow Cyt 1/10 - 1/50.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

Target

Images

  • Anti-Ferritin Heavy Chain antibody - C-terminal (ab194947) at 1/1000 dilution + A2058 cell lysate at 35 µg

    Predicted band size: 21 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human liver tissue, labeling Ferritin Heavy Chain using ab194947 at a 1/100 dilution.

  • Flow cytometry analysis of HepG2 cells labeling Ferritin Heavy Chain (bottom histogram), using ab194947 at a 1/10 dilution, and negative control cells (top histogram). FITC-conjugated Goat anti-Rabbit secondary antibodies were used for the analysis.

References

ab194947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up