Overview

  • Product name

    Anti-Ferritin Light Chain antibody
    See all Ferritin Light Chain primary antibodies
  • Description

    Rabbit polyclonal to Ferritin Light Chain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human Ferritin Light Chain aa 2-175. Two N-terminal tags, (Expressed in E.coli).
    Sequence:

    SSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHF FRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAM ALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTN LHRLGGPEAGLGEYLFERLTLKHD


    Database link: P02792

  • Positive control

    • IHC-P: Human breast cancer, prostate cancer, prostate, cerebrum, skin cancer and colorectal cancer tissues. WB: Pig liver lysate; Recombinant human Ferritin Light Chain protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function

    Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.
  • Involvement in disease

    Defects in FTL are the cause of hereditary hyperferritinemia-cataract syndrome (HHCS) [MIM:600886]. It is an autosomal dominant disease characterized by early-onset bilateral cataract. Affected patients have elevated level of circulating ferritin. HHCS is caused by mutations in the iron responsive element (IRE) of the FTL gene.
    Defects in FTL are the cause of neurodegeneration with brain iron accumulation type 3 (NBIA3) [MIM:606159]; also known as adult-onset basal ganglia disease. It is a movement disorder with heterogeneous presentations starting in the fourth to sixth decade. It is characterized by a variety of neurological signs including parkinsonism, ataxia, corticospinal signs, mild nonprogressive cognitive deficit and episodic psychosis. It is linked with decreased serum ferritin levels.
  • Sequence similarities

    Belongs to the ferritin family.
    Contains 1 ferritin-like diiron domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ferritin L chain antibody
    • Ferritin L subunit antibody
    • Ferritin light chain antibody
    • Ferritin light polypeptide antibody
    • ferritin light polypeptide like 3 antibody
    • FRIL_HUMAN antibody
    • FTL antibody
    • LFTD antibody
    • NBIA 3 antibody
    • NBIA3 antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for Ferritin Light Chain using ab232752 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for Ferritin Light Chain using ab232752 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate tissue stained for Ferritin Light Chain using ab232752 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for Ferritin Light Chain using ab232752 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human skin cancer tissue stained for Ferritin Light Chain using ab232752 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human colorectal cancer tissue stained for Ferritin Light Chain using ab232752 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Ferritin Light Chain antibody (ab232752) at 2 µg/ml + Recombinant human Ferritin Light Chain protein.

    Predicted band size: 20 kDa

  • Anti-Ferritin Light Chain antibody (ab232752) at 2 µg/ml + Pig liver lysate.

    Predicted band size: 20 kDa

References

ab232752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up