Overview

  • Product name

  • Description

    Rabbit polyclonal to Fetuin B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat Fetuin B aa 28-141. Expressed in E. coli. N-terminal tag.
    Sequence:

    NAPFAPLRPLGCNDSEVLAVAGFALQNINRVQKDGYMLTLNRVHDARVHR QEDMGSLFYLMLDVLETGCHVLSRKALKDCGPRIFYETVHGQCKAMFHVN KPRRVLYLPAYNCT


    Database link: Q9QX79

  • Positive control

    • IHC-P: Rat liver tissue. WB: Rat serum. Recombinant rat Fetuin B protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 42 kDa.

Target

  • Tissue specificity

    Liver and testis.
  • Sequence similarities

    Belongs to the fetuin family.
    Contains 2 cystatin fetuin-B-type domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 16G2 antibody
    • 2310011O17Rik antibody
    • AI255764 antibody
    • D17980 antibody
    • Fet antibody
    • Fetub antibody
    • FETUB_HUMAN antibody
    • Fetuin beta antibody
    • Fetuin-B antibody
    • Fetuin-like protein antibody
    • Fetuin-like protein IRL685 antibody
    • Gugu antibody
    • IRL685 antibody
    • Pp63 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Fetuin B with ab232705 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Fetuin B antibody (ab232705) at 1.5 µg/ml + Rat serum

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 42 kDa

  • Anti-Fetuin B antibody (ab232705) at 2 µg/ml + Recombinant rat Fetuin B protein

    Predicted band size: 42 kDa

References

ab232705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up