Overview

  • Product name

  • Description

    Rabbit polyclonal to FFAR3/GPR41
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human FFAR3/GPR41 aa 280-346.
    Sequence:

    SSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTS EHSQGCGTGGQVACAES


    Database link: O14843

  • Positive control

    • WB: Mouse kidney tissue lysate. IHC-P: Human liver cancer and adrenal gland tissues. ICC/IF: HepG2 and A549 cells.
  • General notes

     This product was previously labelled as FFAR3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 39 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Receptor for short chain fatty acids. The activity of this receptor is coupled to the formation of inositol 1,4,5-trisphosphate, intracellular Ca2+ mobilization, the activation of ERK 1/2 and inhibition of intracellular cAMP accumulation. Coupled exclusively to the pertussis toxin-sensitive G(i/o)-alpha protein. The rank order of potency for agonists of this receptor is propionate = pentanoate = butyrate > acetate > formate.
  • Tissue specificity

    Highest level in adipose tissue, and lower expression across all tissues tested.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FFA3R antibody
    • Ffar3 antibody
    • FFAR3_HUMAN antibody
    • Free fatty acid receptor 3 antibody
    • G protein coupled receptor 41 antibody
    • G-protein coupled receptor 41 antibody
    • gpcr41 antibody
    • GPR41 antibody
    • gpr42 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for FFAR3/GPR41 using ab236654 at 1/100 dilution in immunohistochemical analysis.

  • Anti-FFAR3/GPR41 antibody (ab236654) at 1/500 dilution + Mouse kidney tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 39 kDa

  • Paraffin-embedded human adrenal gland tissue stained for FFAR3/GPR41 using ab236654 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for FFAR3/GPR41 (green) using ab236654 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • A549 (human lung carcinoma cell line) cells stained for FFAR3/GPR41 (green) using ab236654 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236654 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236654.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up