Overview

  • Product name

  • Description

    Rabbit polyclonal to FFR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human FFR aa 68-150.
    Sequence:

    FDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFIS ATDTIRKMKNDFRKMEDEMDRLATNMAVITDFS


    Database link: Q9UID3

  • Positive control

    • WB: RT4, U-251 MG, NIH/3T3 and NBT-II cell lysate. IHC-P: Human cerebellum tissue.
  • General notes

     This product was previously labelled as C11orf2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 86 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-FFR antibody (ab224553) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Predicted band size: 86 kDa

  • Paraffin-embedded human cerebellum tissue stained for C11orf12 with ab224553 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-FFR antibody (ab224553) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat Wistar bladdar tumor cell line) cell lysate

    Predicted band size: 86 kDa

References

ab224553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up