Overview

  • Product name

  • Description

    Rabbit polyclonal to FGD5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human FGD5 aa 1203-1462.
    Sequence:

    SRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCG CDFSLTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKK RGRAVPGLMRERPVSMSFPLSSPRFSGSAFSSVFQSINPSTFKKQKKVPS ALTEVAASGEGSAISGYLSRCKRGKRHWKKLWFVIKGKVLYTYMASEDKV ALESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYSFKAEDTNSAQRW IEAMEDASVL


    Database link: Q6ZNL6

  • Positive control

    • IHC-P: Human gastric and bladder cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    FGD5 may activate CDC42, a member of the Ras like family of Rho and Rac proteins, by exchanging bound GDP for free GTP. It may also play a role in regulating the actin cytoskeleton and cell shape. FGD5 contains one DH (DBL-homology) domain one FYVE type zinc finger and two PH domains. There are two isoforms.
  • Cellular localization

    Cytoplasm, cytoskeleton
  • Database links

  • Alternative names

    • FYVE, RhoGEF and PH domain containing protein 5 antibody
    • ZFYVE23 antibody
    • Zinc finger FYVE domain containing protein 23 antibody

Images

  • Paraffin-embedded human gastric cancer tissue stained for FGD5 using ab230119 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder cancer tissue stained for FGD5 using ab230119 at 1/100 dilution in immunohistochemical analysis.

References

ab230119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up