Overview

  • Product name

    Anti-FGF-15 antibody
  • Description

    Rabbit polyclonal to FGF-15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant full length protein within Mouse FGF-15 aa 26-218. The exact sequence is proprietary.
    Sequence:

    RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSV DCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEE DCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHR SFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK


    Database link: O35622

  • Positive control

    • WB: Mouse brain, stomach and skeletal muscle lysates; Rat heart, liver and spleen lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab229630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 25 kDa.

Target

  • Function

    Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression.
  • Tissue specificity

    Expressed in the developing brain.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • FGF-15 antibody
    • Fgf15 antibody
    • FGF15_MOUSE antibody
    • FGF19 antibody
    • Fibroblast growth factor 15 antibody
    see all

Images

  • All lanes : Anti-FGF-15 antibody (ab229630) at 1/500 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse stomach lysate
    Lane 3 : Mouse skeletal muscle lysate
    Lane 4 : Rat heart lysate
    Lane 5 : Rat liver lysate
    Lane 6 : Rat spleen lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 25 kDa

References

ab229630 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up