Overview

  • Product name

    Anti-FGF11 antibody - N-terminal
    See all FGF11 primary antibodies
  • Description

    Rabbit polyclonal to FGF11 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human FGF11 aa 1-30 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. (NP_004103.1).
    Sequence:

    MAALASSLIRQKREVREPGGSRPVSAQRRV


    Database link: Q92914

  • Positive control

    • A2058 cell line lysate; Human kidney tissue; A2058 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab190115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 25 kDa.
IHC-P 1/10 - 1/50.
Flow Cyt 1/10 - 1/50.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Probably involved in nervous system development and function.
  • Tissue specificity

    Nervous system.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Information by UniProt
  • Database links

  • Alternative names

    • FGF 11 antibody
    • FGF-11 antibody
    • FGF11 antibody
    • FGF11_HUMAN antibody
    • FHF 3 antibody
    • FHF-3 antibody
    • FHF3 antibody
    • Fibroblast growth factor 11 antibody
    • Fibroblast growth factor homologous factor 3 antibody
    • FLJ16061 antibody
    • MGC102953 antibody
    • MGC45269 antibody
    see all

Images

  • Anti-FGF11 antibody - N-terminal (ab190115) at 1/1000 dilution + A2058 cell line lysate at 35 µg

    Predicted band size: 25 kDa

  • Flow cytometrical analysis of A2058 cells labeling FGF11 with ab190115 at 1/10 dilution (right histogram) compared to negative control cells (left histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

References

ab190115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up