Overview

  • Product name
  • Description
    Rabbit polyclonal to FGF12
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human FGF12 aa 1-181. Expressed in E.coli.
    Sequence:

    MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVG LRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSST LYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPS LHEIGEKQGRSRKSSGTPTMNGGKVVNQDST


    Database link: P61328-2

  • Positive control
    • IHC-P: Human stomach cancer, cerebrum, kidney, and liver tissues. WB: Recombinant human FGF12; Mouse and rat cerebrum lysate; Rat heart lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 27 kDa.

Target

  • Function
    Probably involved in nervous system development and function.
  • Tissue specificity
    Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.
  • Sequence similarities
    Belongs to the heparin-binding growth factors family.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • EIEE47 antibody
    • FGF-12 antibody
    • Fgf12 antibody
    • FGF12_HUMAN antibody
    • FGF12B antibody
    • FHF-1 antibody
    • FHF1 antibody
    • Fibroblast growth factor 12 antibody
    • Fibroblast growth factor 12B antibody
    • Fibroblast growth factor FGF 12b antibody
    • Fibroblast growth factor homologous factor 1 antibody
    • Myocyte activating factor antibody
    • Myocyte-activating factor antibody
    see all

Images

  • Anti-FGF12 antibody (ab231956) at 1 µg/ml + Rat cerebrum lysate.

    Developed using the ECL technique.

    Predicted band size: 27 kDa

  • Anti-FGF12 antibody (ab231956) at 1 µg/ml + Rat heart lysate.

    Developed using the ECL technique.

    Predicted band size: 27 kDa

  • Anti-FGF12 antibody (ab231956) at 1 µg/ml + Mouse cerebrum lysate.

    Developed using the ECL technique.

    Predicted band size: 27 kDa

  • Anti-FGF12 antibody (ab231956) at 1 µg/ml + Recombinant human FGF12 protein.

    Developed using the ECL technique.

    Predicted band size: 27 kDa

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for FGF12 using ab231956 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for FGF12 using ab231956 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for FGF12 using ab231956 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for FGF12 using ab231956 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up