
  • Product name
  • Description
    Mouse monoclonal to FGFR2
  • Host species
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity
    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment, corresponding to amino acids 621-724 of Human FGFR2

  • Positive control
  • General notes

    This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.



Our Abpromise guarantee covers the use of ab58201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.

This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.

IHC-P Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.


  • Function
    Receptor for acidic and basic fibroblast growth factors.
  • Involvement in disease
    Defects in FGFR2 are the cause of Crouzon syndrome (CS) [MIM:123500]; also called craniofacial dysostosis type I (CFD1). CS is an autosomal dominant syndrome characterized by craniosynostosis (premature fusion of the skull sutures), hypertelorism, exophthalmos and external strabismus, parrot-beaked nose, short upper lip, hypoplastic maxilla, and a relative mandibular prognathism.
    Defects in FGFR2 are a cause of Jackson-Weiss syndrome (JWS) [MIM:123150]. JWS is an autosomal dominant craniosynostosis syndrome characterized by craniofacial abnormalities and abnormality of the feet: broad great toes with medial deviation and tarsal-metatarsal coalescence.
    Defects in FGFR2 are a cause of Apert syndrome (APRS) [MIM:101200]; also known as acrocephalosyndactyly type 1 (ACS1). APRS is a syndrome characterized by facio-cranio-synostosis, osseous and membranous syndactyly of the four extremities, and midface hypoplasia. The craniosynostosis is bicoronal and results in acrocephaly of brachysphenocephalic type. Syndactyly of the fingers and toes may be total (mitten hands and sock feet) or partial affecting the second, third, and fourth digits. Intellectual deficit is frequent and often severe, usually being associated with cerebral malformations.
    Defects in FGFR2 are a cause of Pfeiffer syndrome (PS) [MIM:101600]; also known as acrocephalosyndactyly type V (ACS5). PS is characterized by craniosynostosis (premature fusion of the skull sutures) with deviation and enlargement of the thumbs and great toes, brachymesophalangy, with phalangeal ankylosis and a varying degree of soft tissue syndactyly. Three subtypes of Pfeiffer syndrome have been described: mild autosomal dominant form (type 1); cloverleaf skull, elbow ankylosis, early death, sporadic (type 2); craniosynostosis, early demise, sporadic (type 3).
    Defects in FGFR2 are the cause of Beare-Stevenson cutis gyrata syndrome (BSCGS) [MIM:123790]. BSCGS is an autosomal dominant condition is characterized by the furrowed skin disorder of cutis gyrata, acanthosis nigricans, craniosynostosis, craniofacial dysmorphism, digital anomalies, umbilical and anogenital abnormalities and early death.
    Defects in FGFR2 are the cause of familial scaphocephaly syndrome (FSPC) [MIM:609579]; also known as scaphocephaly with maxillary retrusion and mental retardation. FSPC is an autosomal dominant craniosynostosis syndrome characterized by scaphocephaly, macrocephaly, hypertelorism, maxillary retrusion, and mild intellectual disability. Scaphocephaly is the most common of the craniosynostosis conditions and is characterized by a long, narrow head. It is due to premature fusion of the sagittal suture or from external deformation.
    Defects in FGFR2 are a cause of lacrimo-auriculo-dento-digital syndrome (LADDS) [MIM:149730]; also known as Levy-Hollister syndrome. LADDS is a form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. LADDS is an autosomal dominant syndrome characterized by aplastic/hypoplastic lacrimal and salivary glands and ducts, cup-shaped ears, hearing loss, hypodontia and enamel hypoplasia, and distal limb segments anomalies. In addition to these cardinal features, facial dysmorphism, malformations of the kidney and respiratory system and abnormal genitalia have been reported. Craniosynostosis and severe syndactyly are not observed.
    Defects in FGFR2 are the cause of Antley-Bixler syndrome (ABS) [MIM:207410]. ABS is a multiple congenital anomaly syndrome characterized by craniosynostosis, radiohumeral synostosis, midface hypoplasia, malformed ears, arachnodactyly and multiple joint contractures. ABS is a heterogeneous disorder and occurs with and without abnormal genitalia in both sexes.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • bacteria-expressed kinase antibody
    • BBDS antibody
    • BEK antibody
    • BEK fibroblast growth factor receptor antibody
    • BFR1 antibody
    • CD332 antibody
    • CD332 antigen antibody
    • CEK3 antibody
    • CFD1 antibody
    • Craniofacial dysostosis 1 antibody
    • ECT1 antibody
    • FGF receptor antibody
    • FGFR 2 antibody
    • FGFR-2 antibody
    • Fgfr2 antibody
    • FGFR2_HUMAN antibody
    • Fibroblast growth factor receptor 2 antibody
    • Hydroxyaryl protein kinase antibody
    • Jackson Weiss syndrome antibody
    • JWS antibody
    • K SAM antibody
    • K-sam antibody
    • Keratinocyte growth factor receptor 2 antibody
    • Keratinocyte growth factor receptor antibody
    • KGFR antibody
    • KSAM antibody
    • protein tyrosine kinase, receptor like 14 antibody
    • soluble FGFR4 variant 4 antibody
    • TK14 antibody
    • TK25 antibody
    see all


  • FGFR2 antibody (ab58201) used in immunohistochemistry at 5ug/ml on formalin fixed and paraffin embedded human stomach carcinoma tissue.

    This image was generated using the ascites version of the product.

  • Western blot against tagged recombinant protein immunogen using ab58201 FGFR2 antibody at 1ug/ml. Predicted band size of immunogen is 38 kDa

    This image was generated using the ascites version of the product.

  • ab40880 staining FGFR2 in Human glioblastoma cell line D54MG by Immunocytochemistry/ Immunofluorescence. Cells were fixed in paraformaldehyde and permeabilized in 0.1% Triton X-100 prior to blocking in 0.5% BSA for 30 minutes at room temperature. The primary antibody was diluted 1/50 and incubated with the sample for 16 hours at 4°C. The secondary antibody was TRITC-conjugated Goat anti-Mouse polyclonal, diluted 1/300.

    This image was generated using the ascites version of the product.

    See Abreview

  • Overlay histogram showing HeLa cells stained with ab58201 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab58201, 2µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.

    This image was generated using the ascites version of the product.

  • Immunohistochemical analysis of Human gastric adenocarcinoma, staining FGFR2 with ab58201 at 0.2 µg/ml.

    This image was generated using the ascites version of the product.


This product has been referenced in:
  • Pu XH  et al. Low-level clonal FGFR2 amplification defines a unique molecular subtype of intrahepatic cholangiocarcinoma in a Chinese population. Hum Pathol 76:100-109 (2018). IHC-P . Read more (PubMed: 29514108) »
  • Siegfried JM  et al. Interaction between the estrogen receptor and fibroblast growth factor receptor pathways in non-small cell lung cancer. Oncotarget 8:24063-24076 (2017). WB . Read more (PubMed: 28445992) »
See all 9 Publications for this product

Customer reviews and Q&As

1-10 of 13 Abreviews or Q&A

Western blot
Mouse Tissue lysate - whole (lung, brain, skull)
Gel Running Conditions
Reduced Denaturing (4-12%)
Loading amount
20 µg
lung, brain, skull
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Xianrui Yang

Verified customer

Submitted Feb 20 2017

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Human Tissue sections (tonsil)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Bond Epitope Retrieval 1

Abcam user community

Verified customer

Submitted Apr 10 2013

Western blot
Human Cell lysate - whole cell (293F transfected)
Loading amount
10 µg
293F transfected
Gel Running Conditions
Reduced Denaturing (4-12% Bis-Tris)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Feb 15 2013


Thank you for your enquiry.
The immunogen used to raise this antibody was a FGFR2 (621 a.a. ˜ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. The sequence is: GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
If you need any further assistance in the future, please do not hesitate to contact me.

Read More


Thank you for your enquiry and interest in our products.
As the datasheet indicates, the immunoge sequence used to raise ab58201 was a recombinant fragment, corresponding to amino acids 621-724 of Human FGFR2 (the exact sequence is commercially sensitive information).
Regarding the antigen retreival, there are two methods of antigen retrieval are
1) enzymatic and
2) heat mediated
Both serve to break the methylene bridges and so expose the antigenic sites in order to allow the antibodies to bind. Some antigens prefer enzymatic to heat mediated antigen retrieval and vice versa. Enzymatic tends to be a much gentler process than heated mediated, so is best suited to more friable tissues. However, enzymatic tends to take longer and is more technically demanding.
If no antigen retrieval step is stated on the antibody data sheet, start off by trying the heat mediated pressure cooker method.
If you need any further assistance in the future, please do not hesitate to contact me.

Read More


Selon nos informations vous avez connu quelques difficultés avec ab58201 et avez contacté notre service scientifique.

Après étude de notre correspondance, nous remarquons que nous sommes toujours en attente du questionnaire qui nous permettrait de vous aider à résoudre ce problème. Si vous avez déjà envoyé ce questionnaire, il semble que celui-ci n’est pas était pris en compte par notre système et je vous serais gré de me le transmettre de nouveau. Veuillez nous excuser par le désagrément causé par cette mesure.

Dans le cas contraire, pourriez-vous me faire savoir si vous avez déjà résolu ce problème et ainsi nous pourrions clore ce dossier dans notre système.

Je vous souhaite bonne chance dans vos recherches. N’hésitez pas à me recontacter pour plus d’assistance.

Read More


Je suis désolée que le ab58201 ne vous donne pas de bons résultats en Western blot.

Veuillez trouver ci-jointle questionnaire que nous avons discuté au téléphone et qui nous permet de regrouper le plus d'informations possible sur le protocole que vous avez utilisé avec cet anticorps. Celui-ci nous permettra de vous fournir la meilleure assistance technique.

Si nous concluons que notre produit est fautif et ne fonctionne pas comme explicité par notre fiche technique, nous serons ravis de mettre en place l'envoi d'un tube de remplacement gratuit ou d'un remboursement (sous réserve d'une commande ultérieure de 180 jours).

Je vous remercie par avance de nous envoyer votre protocole.

Read More
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Human Tissue sections (Colon)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TRIS-EDTA Buffer (pH 9.0
Yes - DAKO Wash-Buffer with Tween

Mr. Rudolf Jung

Verified customer

Submitted Dec 06 2011


As indicated on the datasheet, the immunogen used to raise ab58201 is aa 621-724 of the Human FGFR2 (http://www.uniprot.org/uniprot/P21802). This fragment shows 94% homology with FGFR1, 95% with FGFR3, 89% with FGFR4, 100% with isoforms IIIb (http://www.uniprot.org/blast/?about=P21802-18) and 100% with IIIc (http://www.uniprot.org/blast/?about=P21802-5).

Read More
Immunocytochemistry/ Immunofluorescence
Rat Cell (glioma cell line C6 (rat))
glioma cell line C6 (rat)
Yes - 0,1% Triton X 100
Blocking step
BSA as blocking agent for 20 minute(s) · Concentration: 0.5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Sep 23 2011

1-10 of 13 Abreviews or Q&A

For licensing inquiries, please contact partnerships@abcam.com

Sign up