For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    fhfumarase-antibody-ab191367.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Energy Metabolism
Share by email

Anti-FH/Fumarase antibody (ab191367)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-FH/Fumarase antibody (ab191367)
  • Western blot - Anti-FH/Fumarase antibody (ab191367)
  • Western blot - Anti-FH/Fumarase antibody (ab191367)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FH/Fumarase antibody (ab191367)
  • Immunocytochemistry/ Immunofluorescence - Anti-FH/Fumarase antibody (ab191367)

Key features and details

  • Rabbit polyclonal to FH/Fumarase
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant human FH/Fumarase protein (ab168013)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-FH/Fumarase antibody
    See all FH/Fumarase primary antibodies
  • Description

    Rabbit polyclonal to FH/Fumarase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment within Human FH/Fumarase aa 89-365. The exact sequence is proprietary.
    Sequence:

    PTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPL VVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSN DTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQD AVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIG FAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKI ANDIRFLGSGPRSGLGELILPENEPGS


    Database link: P07954
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human liver tissue; HeLa cells; rat and mouse liver tissue lysates; 293T and A431 cell lysates.
  • General notes

     This product was previously labelled as FH

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 89% Tris glycine, 10% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Cancer
    • Oncoproteins/suppressors
    • Tumor suppressors
    • Other
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Integration of energy metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Integration of energy

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • Mouse liver tissue lysate - total protein (ab29301)
    • A431 whole cell lysate (ab30132)
    • A431 whole cell lysate (ab7909)
  • Recombinant Protein

    • Recombinant human FH/Fumarase protein (ab168013)
  • Related Products

    • Recombinant human FH/Fumarase protein (ab168013)
    • Recombinant Human FH/Fumarase protein (ab82790)

Applications

Our Abpromise guarantee covers the use of ab191367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/10000. Predicted molecular weight: 54 kDa.
IHC-P Use a concentration of 7.5 µg/ml.
ICC/IF 1/100 - 1/1000.

Target

  • Function

    Also acts as a tumor suppressor.
  • Pathway

    Carbohydrate metabolism; tricarboxylic acid cycle; (S)-malate from fumarate: step 1/1.
  • Involvement in disease

    Defects in FH are the cause of fumarase deficiency (FHD) [MIM:606812]; also known as fumaricaciduria. FHD is characterized by progressive encephalopathy, developmental delay, hypotonia, cerebral atrophy and lactic and pyruvic acidemia.
    Defects in FH are the cause of multiple cutaneous and uterine leiomyomata (MCUL1) [MIM:150800]. MCUL1 is an autosomal dominant condition in which affected individuals develop benign smooth muscle tumors (leiomyomata) of the skin. Affected females also usually develop leiomyomata of the uterus (fibroids).
    Defects in FH are the cause of hereditary leiomyomatosis and renal cell cancer (HLRCC) [MIM:605839].
  • Sequence similarities

    Belongs to the class-II fumarase/aspartase family. Fumarase subfamily.
  • Cellular localization

    Cytoplasm and Mitochondrion.
  • Target information above from: UniProt accession P07954 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 2271 Human
    • Entrez Gene: 14194 Mouse
    • Entrez Gene: 24368 Rat
    • Omim: 136850 Human
    • SwissProt: P07954 Human
    • SwissProt: P97807 Mouse
    • SwissProt: P14408 Rat
    • Unigene: 592490 Human
    • Unigene: 41502 Mouse
    • Unigene: 29782 Rat
    see all
  • Alternative names

    • FH antibody
    • Fumarase antibody
    • Fumarate hydratase antibody
    • Fumarate hydratase mitochondrial antibody
    • Fumarate hydratase, mitochondrial antibody
    • FUMH_HUMAN antibody
    • HLRCC antibody
    • LRCC antibody
    • MCL antibody
    • MCUL 1 antibody
    • MCUL1 antibody
    • MS709 antibody
    • Multiple hereditary cutaneous leiomyomata antibody
    see all

Images

  • Western blot - Anti-FH/Fumarase antibody (ab191367)
    Western blot - Anti-FH/Fumarase antibody (ab191367)
    All lanes : Anti-FH/Fumarase antibody (ab191367) at 1/5000 dilution

    Lane 1 : 293T cell lysate
    Lane 2 : A431 cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 54 kDa



    10% SDS Page

  • Western blot - Anti-FH/Fumarase antibody (ab191367)
    Western blot - Anti-FH/Fumarase antibody (ab191367)
    Anti-FH/Fumarase antibody (ab191367) at 1/1000 dilution + mouse liver lysate at 50 µg

    Predicted band size: 54 kDa



    10% SDS Page

  • Western blot - Anti-FH/Fumarase antibody (ab191367)
    Western blot - Anti-FH/Fumarase antibody (ab191367)
    Anti-FH/Fumarase antibody (ab191367) at 1/5000 dilution + rat liver tissue lysate at 50 µg

    Predicted band size: 54 kDa



    10% SDS Page

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FH/Fumarase antibody (ab191367)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FH/Fumarase antibody (ab191367)

    Immunohistochemical analysis of formalin fixed, paraffin embedded Human liver tissue labeling FH/Fumarase using ab191367 at 7.5 µg/ml.

  • Immunocytochemistry/ Immunofluorescence - Anti-FH/Fumarase antibody (ab191367)
    Immunocytochemistry/ Immunofluorescence - Anti-FH/Fumarase antibody (ab191367)

    Immunofluorescence analysis of methanol-fixed HeLa cells labeling FH/Fumarase using ab191367 at 1/200 dilution. Bottom image shows Hoechst 33342 counterstain.

Protocols

  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab191367? Please let us know so that we can cite the reference in this datasheet.

    ab191367 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab191367.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.