Anti-FH/Fumarase antibody (ab191367)
Key features and details
- Rabbit polyclonal to FH/Fumarase
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-FH/Fumarase antibody
See all FH/Fumarase primary antibodies -
Description
Rabbit polyclonal to FH/Fumarase -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment within Human FH/Fumarase aa 89-365. The exact sequence is proprietary.
Sequence:PTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPL VVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSN DTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQD AVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIG FAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKI ANDIRFLGSGPRSGLGELILPENEPGS
Database link: P07954 -
Positive control
- Human liver tissue; HeLa cells; rat and mouse liver tissue lysates; 293T and A431 cell lysates.
-
General notes
This product was previously labelled as FH
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 89% Tris glycine, 10% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab191367 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/10000. Predicted molecular weight: 54 kDa. | |
IHC-P | Use a concentration of 7.5 µg/ml. | |
ICC/IF | 1/100 - 1/1000. |
Target
-
Function
Also acts as a tumor suppressor. -
Pathway
Carbohydrate metabolism; tricarboxylic acid cycle; (S)-malate from fumarate: step 1/1. -
Involvement in disease
Defects in FH are the cause of fumarase deficiency (FHD) [MIM:606812]; also known as fumaricaciduria. FHD is characterized by progressive encephalopathy, developmental delay, hypotonia, cerebral atrophy and lactic and pyruvic acidemia.
Defects in FH are the cause of multiple cutaneous and uterine leiomyomata (MCUL1) [MIM:150800]. MCUL1 is an autosomal dominant condition in which affected individuals develop benign smooth muscle tumors (leiomyomata) of the skin. Affected females also usually develop leiomyomata of the uterus (fibroids).
Defects in FH are the cause of hereditary leiomyomatosis and renal cell cancer (HLRCC) [MIM:605839]. -
Sequence similarities
Belongs to the class-II fumarase/aspartase family. Fumarase subfamily. -
Cellular localization
Cytoplasm and Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 2271 Human
- Entrez Gene: 14194 Mouse
- Entrez Gene: 24368 Rat
- Omim: 136850 Human
- SwissProt: P07954 Human
- SwissProt: P97807 Mouse
- SwissProt: P14408 Rat
- Unigene: 592490 Human
see all -
Alternative names
- FH antibody
- Fumarase antibody
- Fumarate hydratase antibody
see all
Images
-
All lanes : Anti-FH/Fumarase antibody (ab191367) at 1/5000 dilution
Lane 1 : 293T cell lysate
Lane 2 : A431 cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 54 kDa10% SDS Page
-
Anti-FH/Fumarase antibody (ab191367) at 1/1000 dilution + mouse liver lysate at 50 µg
Predicted band size: 54 kDa10% SDS Page
-
Anti-FH/Fumarase antibody (ab191367) at 1/5000 dilution + rat liver tissue lysate at 50 µg
Predicted band size: 54 kDa10% SDS Page
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FH/Fumarase antibody (ab191367)
Immunohistochemical analysis of formalin fixed, paraffin embedded Human liver tissue labeling FH/Fumarase using ab191367 at 7.5 µg/ml.
-
Immunofluorescence analysis of methanol-fixed HeLa cells labeling FH/Fumarase using ab191367 at 1/200 dilution. Bottom image shows Hoechst 33342 counterstain.
Protocols
References (0)
ab191367 has not yet been referenced specifically in any publications.