Overview

  • Product name

  • Description

    Rabbit polyclonal to FHOD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FHOD1 aa 469-583.
    Sequence:

    AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEP LIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKD IPAPSPPLPLLSGVP


    Database link: Q9Y613

  • Positive control

    • IHC-P: Human lymph node tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Required for the assembly of F-actin structures, such as stress fibers. Depends on the Rho-ROCK cascade for its activity. Contributes to the coordination of microtubules with actin fibers and plays a role in cell elongation.
  • Tissue specificity

    Ubiquitous. Highly expressed in spleen.
  • Sequence similarities

    Belongs to the formin homology family.
    Contains 1 FH1 (formin homology 1) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Domain

    Regulated by intramolecular binding to a C-terminal auto-inhibitory domain. Effector binding abolishes this interaction and activates the protein.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Predominantly cytoplasmic.
  • Information by UniProt
  • Database links

  • Alternative names

    • FH1/FH2 domain containing protein antibody
    • FH1/FH2 domain containing protein 1 antibody
    • FH1/FH2 domain-containing protein 1 antibody
    • Fhod1 antibody
    • FHOD1_HUMAN antibody
    • FHOS antibody
    • FHOS1 antibody
    • Formin homolog overexpressed in spleen 1 antibody
    • Formin homology 2 domain containing 1 antibody
    • Formin homology 2 domain containing protein 1 antibody
    • Formin homology 2 domain-containing protein 1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for FHOD1 (green) using ab224461 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human lymph node tissue stained for FHOD1 using ab224461 at 1/200 dilution in immunohistochemical analysis.

References

ab224461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up