Overview

  • Product name

    Anti-FHOD3 antibody
  • Description

    Rabbit polyclonal to FHOD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FHOD3 aa 667-792.
    Sequence:

    QCGDILTNKRFMLDMLYAHNRKSPDDEEKGDGEAGRTQQEAEAVASLATR ISTLQANSQTQDESVRRVDVGCLDNRGSVKAFAEKFNSGDLGRGSISPDA EPNDKVPETAPVQPKTESDYIWDQLM


    Database link: Q2V2M9

  • Positive control

    • IHC-P: Human urinary bladder tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Actin-organizing protein that may cause stress fiber formation together with cell elongation.
  • Tissue specificity

    Expressed in the heart, kidney and brain.
  • Sequence similarities

    Belongs to the formin homology family.
    Contains 1 DAD (diaphanous autoregulatory) domain.
    Contains 1 FH1 (formin homology 1) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Cellular localization

    Cytoplasm > cytoskeleton. Main part of the protein localizes to actin fibers and the remaining part displays filamentous staining.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ22717 antibody
    • Formactin2 antibody
    • FH1/FH2 domain containing protein 3 antibody
    • FH1/FH2 domain-containing protein 3 antibody
    • Fhod3 antibody
    • FHOD3_HUMAN antibody
    • FHOS2 antibody
    • FLJ22297 antibody
    • Formactin-2 antibody
    • Formin homolog overexpressed in spleen 2 antibody
    • Formin homology 2 domain containing 3 antibody
    • hFHOS2 antibody
    • KIAA1695 antibody
    • mKIAA1695 antibody
    see all

Images

  • Paraffin-embedded human urinary bladder tissue stained for FHOD3 using ab224463 at 1/50 dilution in immunohistochemical analysis.

References

ab224463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up