Anti-FIAT antibody (ab224215)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-FIAT antibody -
Description
Rabbit polyclonal to FIAT -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human FIAT aa 96-216.
Sequence:VSPAYCTQESREEIPGGEARTDPPDGQQDSECNRNKEKTLGKEVLLLMQA LNTLSTPEEKLAALCKKYADLLEESRSVQKQMKILQKKQAQIVKEKVHLQ SEHSKAILARSKLESLCRELQ
Database link: Q9NUQ3 -
Positive control
- WB: RT4, EFO-21, A431, NIH/3T3 and NBT-II cell lysates. IHC-P: Human bone marrow tissue.
-
General notes
Previously labelled as Gamma-taxilin.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab224215 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/250 - 1/500. Predicted molecular weight: 61 kDa. | |
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May be involved in intracellular vesicle traffic. Inhibits ATF4-mediated transcription, possibly by dimerizing with ATF4 to form inactive dimers that cannot bind DNA. May be involved in regulating bone mass density through an ATF4-dependent pathway. May be involved in cell cycle progression. -
Tissue specificity
Ubiquitously expressed. Expressed at high level in heart and skeletal muscle. Expressed in brain, placenta, lung, liver, kidney and pancreas. -
Sequence similarities
Belongs to the taxilin family. -
Cellular localization
Nucleus membrane. Cytoplasm > cytosol. - Information by UniProt
-
Database links
- Entrez Gene: 55787 Human
- Entrez Gene: 353170 Mouse
- Entrez Gene: 302680 Rat
- Omim: 300667 Human
- SwissProt: Q9NUQ3 Human
- SwissProt: Q8BHN1 Mouse
- Unigene: 555961 Human
- Unigene: 270186 Mouse
see all -
Alternative names
- chromosome X open reading frame 15 antibody
- CXorf15 antibody
- Environmental lipopolysaccharide-responding gene protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FIAT antibody (ab224215)Paraffin-embedded human bone marrow tissue stained for FIAT using ab224215 at 1/500 dilution in immunohistochemical analysis.
-
Western blot - Anti-FIAT antibody (ab224215)All lanes : Anti-FIAT antibody (ab224215) at 1/250 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : EFO-21 cell lysate
Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate
Developed using the ECL technique.
Predicted band size: 61 kDa -
Western blot - Anti-FIAT antibody (ab224215)All lanes : Anti-FIAT antibody (ab224215) at 1/250 dilution
Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
Lane 2 : NBT-II (rat Wistar bladder tumor cell line) cell lysate
Developed using the ECL technique.
Predicted band size: 61 kDa
Datasheets and documents
References
ab224215 has not yet been referenced specifically in any publications.
