Anti-FIAT antibody (ab224215)
Key features and details
- Rabbit polyclonal to FIAT
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-FIAT antibody -
Description
Rabbit polyclonal to FIAT -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human FIAT aa 96-216.
Sequence:VSPAYCTQESREEIPGGEARTDPPDGQQDSECNRNKEKTLGKEVLLLMQA LNTLSTPEEKLAALCKKYADLLEESRSVQKQMKILQKKQAQIVKEKVHLQ SEHSKAILARSKLESLCRELQ
Database link: Q9NUQ3 -
Positive control
- WB: RT4, EFO-21, A431, NIH/3T3 and NBT-II cell lysates. IHC-P: Human bone marrow tissue.
-
General notes
Previously labelled as Gamma-taxilin.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab224215 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 61 kDa. | |
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May be involved in intracellular vesicle traffic. Inhibits ATF4-mediated transcription, possibly by dimerizing with ATF4 to form inactive dimers that cannot bind DNA. May be involved in regulating bone mass density through an ATF4-dependent pathway. May be involved in cell cycle progression. -
Tissue specificity
Ubiquitously expressed. Expressed at high level in heart and skeletal muscle. Expressed in brain, placenta, lung, liver, kidney and pancreas. -
Sequence similarities
Belongs to the taxilin family. -
Cellular localization
Nucleus membrane. Cytoplasm > cytosol. - Information by UniProt
-
Database links
- Entrez Gene: 55787 Human
- Entrez Gene: 353170 Mouse
- Entrez Gene: 302680 Rat
- Omim: 300667 Human
- SwissProt: Q9NUQ3 Human
- SwissProt: Q8BHN1 Mouse
- Unigene: 555961 Human
- Unigene: 270186 Mouse
see all -
Alternative names
- chromosome X open reading frame 15 antibody
- CXorf15 antibody
- Environmental lipopolysaccharide-responding gene protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FIAT antibody (ab224215)
Paraffin-embedded human bone marrow tissue stained for FIAT using ab224215 at 1/500 dilution in immunohistochemical analysis.
-
All lanes : Anti-FIAT antibody (ab224215) at 1/250 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : EFO-21 cell lysate
Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate
Developed using the ECL technique.
Predicted band size: 61 kDa -
All lanes : Anti-FIAT antibody (ab224215) at 1/250 dilution
Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
Lane 2 : NBT-II (rat Wistar bladder tumor cell line) cell lysate
Developed using the ECL technique.
Predicted band size: 61 kDa
Protocols
Datasheets and documents
References (0)
ab224215 has not yet been referenced specifically in any publications.