Overview

  • Product name

  • Description

    Rabbit polyclonal to FIBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FIBP aa 1-364.
    Sequence:

    MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAA VLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFD EAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEE MRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFA FCAELMIQNWTLGAVGEAPTDPDSQMDDMDMDLDKEFLQDLKELKVLVAD KDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVR DLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRY MGTLRGCLLRLYHD


    Database link: O43427

  • Positive control

    • IHC-P: Human prostate cancer and testis tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May be involved in mitogenic function of FGF1.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.
  • Cellular localization

    Nucleus. Endomembrane system. Also associated with cytoplasmic membranes, particularly of mitochondria.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acidic fibroblast growth factor intracellular-binding protein antibody
    • aFGF intracellular-binding protein antibody
    • FGF-1 intracellular-binding protein antibody
    • FGFIBP antibody
    • FIBP antibody
    • FIBP-1 antibody
    • FIBP_HUMAN antibody
    • FIBP1 antibody
    • fibroblast growth factor (acidic) intracellular binding protein antibody
    • OTTHUMP00000234231 antibody
    • OTTHUMP00000234232 antibody
    • OTTHUMP00000234233 antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for FIBP using ab234774 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for FIBP using ab234774 at 1/100 dilution in immunohistochemical analysis.

References

ab234774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up