Overview

  • Product name

  • Description

    Rabbit polyclonal to FIBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FIBP aa 2-357.
    Sequence:

    TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAV LQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDE AFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEM RGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAF CAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHK SLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVE KFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCL LRLYHD


    Database link: O43427-2

  • Positive control

    • WB: MCF7 whole cell lysate. IHC-P: Human testis and pancreatic tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 42 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May be involved in mitogenic function of FGF1.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.
  • Cellular localization

    Nucleus. Endomembrane system. Also associated with cytoplasmic membranes, particularly of mitochondria.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acidic fibroblast growth factor intracellular-binding protein antibody
    • aFGF intracellular-binding protein antibody
    • FGF-1 intracellular-binding protein antibody
    • FGFIBP antibody
    • FIBP antibody
    • FIBP-1 antibody
    • FIBP_HUMAN antibody
    • FIBP1 antibody
    • fibroblast growth factor (acidic) intracellular binding protein antibody
    • OTTHUMP00000234231 antibody
    • OTTHUMP00000234232 antibody
    • OTTHUMP00000234233 antibody
    see all

Images

  • Anti-FIBP antibody (ab236647) at 1/500 dilution + MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 42 kDa

  • Paraffin-embedded human testis tissue stained for FIBP  using ab236647 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic tissue stained for FIBP  using ab236647 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for FIBP (green) using ab236647 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up