Overview

  • Product name

    Anti-Fibrillarin antibody [4A4]
    See all Fibrillarin primary antibodies
  • Description

    Mouse monoclonal [4A4] to Fibrillarin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Fibrillarin aa 1-321. (Purified from E.coli).
    Sequence:

    MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGG GGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICR GKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILG GVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDL INLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNA HTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLE PYERDHAVVVGVYRPPPKVKN


    Database link: P22087

  • Positive control

    • WB: Rat and mouse whole brain lysates; NIH/3T3, Hek293, HeLa and SH-SY5Y cell lysates. ICC/IF: HEK-293, C6 and HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab218846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/5000. Predicted molecular weight: 33 kDa.
ICC/IF 1/1000 - 1/2000.

Target

  • Function

    S-adenosyl-L-methionine-dependent methyltransferase that has the ability to methylate both RNAs and proteins. Involved in pre-rRNA processing by catalyzing the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA. Also acts as a protein methyltransferase by mediating methylation of 'Gln-105' of histone H2A (H2AQ104me), a modification that impairs binding of the FACT complex and is specifically present at 35S ribosomal DNA locus (PubMed:24352239).
  • Sequence similarities

    Belongs to the methyltransferase superfamily. Fibrillarin family.
  • Post-translational
    modifications

    By homology to other fibrillarins, some or all of the N-terminal domain arginines are modified to asymmetric dimethylarginine (DMA).
  • Cellular localization

    Nucleus, nucleolus. Fibrillar region of the nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 34 kD nucleolar scleroderma antigen antibody
    • 34 kDa nucleolar scleroderma antigen antibody
    • Fbl antibody
    • FBRL_HUMAN antibody
    • FIB antibody
    • FIB1 antibody
    • FLRN antibody
    • Histone-glutamine methyltransferase antibody
    • Nop1p antibody
    • RNA U3 small nucleolar interacting protein 1 antibody
    • RNU3IP1 antibody
    • rRNA 2' O methyltransferase fibrillarin antibody
    • rRNA 2'-O-methyltransferase fibrillarin antibody
    see all

Images

  • HEK-293 (human epithelial cell line from embryonic kidney transformed with large T antigen; Panel A) and C6 (rat glial tumor cell line; Panel B) cells stained for Fibrillarin (red) using ab218846 at 1/1000 dilution in ICC/IF. Co-stained with chicken pAb to vimentin, at 1/10000 dilution (green). The blue is DAPI staining of nuclear DNA.

  • All lanes : Anti-Fibrillarin antibody [4A4] (ab218846) at 1/2000 dilution

    Lane 1 : Molecular weight standards
    Lane 2 : Rat whole brain lysate
    Lane 3 : Mouse whole brain lysate
    Lane 4 : NIH/3T3 cell lysate
    Lane 5 : Hek293 cell lysate
    Lane 6 : HeLa cell lysate
    Lane 7 : SH-SY5Y cell lysate

    Predicted band size: 33 kDa



    Fibrillarin detection is shown in green.

    Also stained with a rabbit antibody to UCHL-1 at 1/3000 dilution (red).

  • Immunofluorescent analysis of HeLa cells labeling Fibrillarin with ab218846 at 1/1000 dilution (red). The cells were counterstained with a chicken antibody to vimentin at 1/5000 dilution (green) and DAPI to label the nuclei (blue).

References

ab218846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up