Overview

  • Product name

    Anti-Fibrinogen alpha chain antibody
    See all Fibrinogen alpha chain primary antibodies
  • Description

    Rabbit polyclonal to Fibrinogen alpha chain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse Fibrinogen alpha chain aa 34-255. N-terminal tags. Expressed in E.coli.
    Sequence:

    GVRGPRVVERHQSQCKDSDWPFCSDDDWNHKCPSGCRMKGLIDEANQDFT NRINKLKNSLFDFQRNNKDSNSLTRNIMEYLRGDFANANNFDNTYGQVSE DLRRRIEILRRKVIEKAQQIQALQSNVRAQLIDMKRLEVDIDIKIRSCKG SCSRAVNREINLQDYEGHQKQLQQVIAKELLPTKDRQYLPALKMSPVPDL VPGSFKSQLQEAPPEWKALTEM


    Database link: E9PV24

  • Positive control

    • IHC-P: Mouse liver tissue. WB: Mouse liver and kidney lysates; Human serum; Recombinant mouse Fibrinogen alpha chain protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 87 kDa.

Target

  • Function

    Fibrinogen has a double function: yielding monomers that polymerize into fibrin and acting as a cofactor in platelet aggregation.
  • Tissue specificity

    Plasma.
  • Involvement in disease

    Defects in FGA are a cause of congenital afibrinogenemia (CAFBN) [MIM:202400]. This is a rare autosomal recessive disorder characterized by bleeding that varies from mild to severe and by complete absence or extremely low levels of plasma and platelet fibrinogen. Note=The majority of cases of afibrinogenemia are due to truncating mutations. Variations in position Arg-35 (the site of cleavage of fibrinopeptide a by thrombin) leads to alpha-dysfibrinogenemias.
    Defects in FGA are a cause of amyloidosis type 8 (AMYL8) [MIM:105200]; also known as systemic non-neuropathic amyloidosis or Ostertag-type amyloidosis. AMYL8 is a hereditary generalized amyloidosis due to deposition of apolipoprotein A1, fibrinogen and lysozyme amyloids. Viscera are particularly affected. There is no involvement of the nervous system. Clinical features include renal amyloidosis resulting in nephrotic syndrome, arterial hypertension, hepatosplenomegaly, cholestasis, petechial skin rash.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Domain

    A long coiled coil structure formed by 3 polypeptide chains connects the central nodule to the C-terminal domains (distal nodules). The long C-terminal ends of the alpha chains fold back, contributing a fourth strand to the coiled coil structure.
  • Post-translational
    modifications

    The alpha chain is not glycosylated.
    Forms F13A-mediated cross-links between a glutamine and the epsilon-amino group of a lysine residue, forming fibronectin-fibrinogen heteropolymers.
    About one-third of the alpha chains in the molecules in blood were found to be phosphorylated.
    Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot. The soft clot is converted into the hard clot by factor XIIIA which catalyzes the epsilon-(gamma-glutamyl)lysine cross-linking between gamma chains (stronger) and between alpha chains (weaker) of different monomers.
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ac1873 antibody
    • Fba5e antibody
    • FGA antibody
    • Fib antibody
    • Fib2 antibody
    • FIBA_HUMAN antibody
    • Fibrinogen alpha chain antibody
    • Fibrinogen, A alpha polypeptide antibody
    • Fibrinogen--alpha polypeptide chain antibody
    • Fibrinopeptide A antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for Fibrinogen alpha chain using ab231946 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Fibrinogen alpha chain antibody (ab231946) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 87 kDa

  • Anti-Fibrinogen alpha chain antibody (ab231946) at 2 µg/ml + Human serum

    Predicted band size: 87 kDa

  • Anti-Fibrinogen alpha chain antibody (ab231946) at 2 µg/ml + Mouse kidney lysate

    Predicted band size: 87 kDa

  • Anti-Fibrinogen alpha chain antibody (ab231946) at 2 µg/ml + Recombinant mouse Fibrinogen alpha chain protein

    Predicted band size: 87 kDa

References

ab231946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up