Overview

  • Product name

    Anti-Fibrinogen beta chain antibody
    See all Fibrinogen beta chain primary antibodies
  • Description

    Rabbit polyclonal to Fibrinogen beta chain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Bovine Fibrinogen beta chain aa 49-495. N-terminal His-tag and S-tag (Expressed in E.coli).
    Sequence:

    EFGHRPYDKKKEEAPSLRPVPPPISGGGYRARPATATVGQKKVERKPPDA DGCLHADPDLGVLCPTGCKLQDTLVRQERPIRKSIEDLRNTVDSVSRTSS STFQYITLLKNMWKGRQNQVQDNENVVNEYSSHLEKHQLYIDETVKNNIP TKLRVLRSILENLRSKIQKLESDVSTQMEYCRTPCTVTCNIPVVSGKECE KIIRNEGETSEMYLIQPEDSSKPYRVYCDMKTEKGGWTVIQNRQDGSVDF GRKWDPYKQGFGNIATNAEGKKYCGVPGEYWLGNDRISQLTNMGPTKLLI EMEDWKGDKVTALYEGFTVQNEANKYQLSVSKYKGTAGNALIEGASQLVG ENRTMTIHNSMFFSTYDRDNDGWKTTDPRKQCSKEDGGGWWYNRCHAANP NGRYYWGGAYTWDMAKHGTDDGVVWMNWQGSWYSMKKMSMKIRPYFPEQ


    Database link: F1MAV0

  • Positive control

    • Cow serum; Cow liver and spleen lysates; Rat liver lysate; Recombinant cow Fibrinopeptide B protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 56 kDa.

Target

  • Function

    Fibrinogen has a double function: yielding monomers that polymerize into fibrin and acting as a cofactor in platelet aggregation.
  • Involvement in disease

    Defects in FGB are a cause of congenital afibrinogenemia (CAFBN) [MIM:202400]. This rare autosomal recessive disorder is characterized by bleeding that varies from mild to severe and by complete absence or extremely low levels of plasma and platelet fibrinogen. Note=Patients with congenital fibrinogen abnormalities can manifest different clinical pictures. Some cases are clinically silent, some show a tendency toward bleeding and some show a predisposition for thrombosis with or without bleeding.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Domain

    A long coiled coil structure formed by 3 polypeptide chains connects the central nodule to the C-terminal domains (distal nodules). The long C-terminal ends of the alpha chains fold back, contributing a fourth strand to the coiled coil structure.
  • Post-translational
    modifications

    Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot. The soft clot is converted into the hard clot by factor XIIIA which catalyzes the epsilon-(gamma-glutamyl)lysine cross-linking between gamma chains (stronger) and between alpha chains (weaker) of different monomers.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta fibrinogen antibody
    • Epididymis Secretory Sperm Binding Protein Li 78p antibody
    • FGB antibody
    • FIBB_HUMAN antibody
    • Fibrinogen beta chain antibody
    • Fibrinogen, B Beta Polypeptide antibody
    • HEL-S-78p antibody
    see all

Images

  • Anti-Fibrinogen beta chain antibody (ab231962) at 1 µg/ml + Rat liver lysate

    Predicted band size: 56 kDa

  • Anti-Fibrinogen beta chain antibody (ab231962) at 1 µg/ml + Cow spleen lysate

    Predicted band size: 56 kDa

  • Anti-Fibrinogen beta chain antibody (ab231962) at 1 µg/ml + Cow liver lysate

    Predicted band size: 56 kDa

  • Anti-Fibrinogen beta chain antibody (ab231962) at 1 µg/ml + Cow serum

    Predicted band size: 56 kDa

  • Anti-Fibrinogen beta chain antibody (ab231962) at 1 µg/ml + Recombinant cow Fibrinopeptide B protein

    Predicted band size: 56 kDa

References

ab231962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up