Overview

  • Product name

    Anti-Fibrinogen beta chain antibody
    See all Fibrinogen beta chain primary antibodies
  • Description

    Rabbit polyclonal to Fibrinogen beta chain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Fibrinogen beta chain aa 45-491. Mature chain. Expressed in E.coli.
    Sequence:

    GHRPLDKKREEAPSLRPAPPPISGGGYRARPAKAAATQKKVERKAPDAGG CLHADPDLGVLCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQTSSSS FQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTN LRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEI IRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGR KWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEM EDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGEN RTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNG RYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ


    Database link: P02675

  • Positive control

    • WB: Recombinant human Fibrinogen beta chain; Human urine; Mouse heart lysate; Pig brain lysate. IHC-P: Human liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 56 kDa.

Target

  • Function

    Fibrinogen has a double function: yielding monomers that polymerize into fibrin and acting as a cofactor in platelet aggregation.
  • Involvement in disease

    Defects in FGB are a cause of congenital afibrinogenemia (CAFBN) [MIM:202400]. This rare autosomal recessive disorder is characterized by bleeding that varies from mild to severe and by complete absence or extremely low levels of plasma and platelet fibrinogen. Note=Patients with congenital fibrinogen abnormalities can manifest different clinical pictures. Some cases are clinically silent, some show a tendency toward bleeding and some show a predisposition for thrombosis with or without bleeding.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Domain

    A long coiled coil structure formed by 3 polypeptide chains connects the central nodule to the C-terminal domains (distal nodules). The long C-terminal ends of the alpha chains fold back, contributing a fourth strand to the coiled coil structure.
  • Post-translational
    modifications

    Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot. The soft clot is converted into the hard clot by factor XIIIA which catalyzes the epsilon-(gamma-glutamyl)lysine cross-linking between gamma chains (stronger) and between alpha chains (weaker) of different monomers.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta fibrinogen antibody
    • Epididymis Secretory Sperm Binding Protein Li 78p antibody
    • FGB antibody
    • FIBB_HUMAN antibody
    • Fibrinogen beta chain antibody
    • Fibrinogen, B Beta Polypeptide antibody
    • HEL-S-78p antibody
    see all

Images

  • Anti-Fibrinogen beta chain antibody (ab232793) at 2 µg + Recombinant human Fibrinogen beta chain protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 56 kDa

  • All lanes : Anti-Fibrinogen beta chain antibody (ab232793) at 2 µg/ml

    Lane 1 : Human urine
    Lane 2 : Mouse heart lysate
    Lane 3 : Pig brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 56 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Fibrinogen beta chain using ab232793 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up