Overview

  • Product name

    Anti-Fibrinogen gamma chain antibody
    See all Fibrinogen gamma chain primary antibodies
  • Description

    Rabbit polyclonal to Fibrinogen gamma chain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow Fibrinogen gamma chain aa 168-444. Expressed in E.coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFKIHDVTGRDCQDVA NKGAKESGLYFIRPLKAKQFLVYCEIDGSGNGWTVFQKRLDGSLDFKKNW IQYKEGFGHLSPTGTGNTEFWLGNEKIHLISTQSSIPYVLRIQLEDWNGR TSTADYASFKVTGENDKYRLTYAYFIGGDAGDAFDGYDFGDDSSDKFFTS HNGMQFSTWDSDNDKYDGNCAEQVGIGWWMNKCHAGHLNGVYYQGGTYSK TSTPNGYDNGIIWATWKSRWYSMKKTTMKIIPLNRLAIGEGQQHQLGGAK QVGVEHHVEIEYD


    Database link: P12799

  • Positive control

    • WB: Recombinant cow Fibrinogen gamma chain; Cow liver lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 50 kDa.

Target

  • Function

    Fibrinogen has a double function: yielding monomers that polymerize into fibrin and acting as a cofactor in platelet aggregation.
  • Involvement in disease

    Defects in FGG are a cause of thrombophilia.
    Defects in FGG are a cause of congenital afibrinogenemia (CAFBN) [MIM:202400]. It is a rare autosomal recessive disorder characterized by complete absence of detectable fibrinogen.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Domain

    A long coiled coil structure formed by 3 polypeptide chains connects the central nodule to the C-terminal domains (distal nodules). The long C-terminal ends of the alpha chains fold back, contributing a fourth strand to the coiled coil structure.
  • Post-translational
    modifications

    Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot. The soft clot is converted into the hard clot by factor XIIIA which catalyzes the epsilon-(gamma-glutamyl)lysine cross-linking between gamma chains (stronger) and between alpha chains (weaker) of different monomers.
    Sulfation of C-terminal tyrosines increases affinity for thrombin.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • FGG antibody
    • FIBG_HUMAN antibody
    • Fibrinogen gamma chain antibody
    • Fibrinogen gamma polypeptide antibody
    • fibrinogen gamma-b chain antibody
    see all

Images

  • Anti-Fibrinogen gamma chain antibody (ab231337) at 2 µg/ml + Recombinant cow Fibrinogen gamma chain

    Predicted band size: 50 kDa

  • Anti-Fibrinogen gamma chain antibody (ab231337) at 2 µg/ml + Cow liver lysate

    Predicted band size: 50 kDa

References

ab231337 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231337.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up