Overview

  • Product name

  • Description

    Rabbit polyclonal to Fibulin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Rat Fibulin 1 aa 127-243. N-terminal His and GST Tag. Expressed in E.coli.
    Sequence:

    EPNLMISYQCGLVFRACCVKGQENSDFVRGDGTDLQDPAKIPEEEEQEDP YLNDRCRGGGPCKQQCRDTGDEVICSCFVGYQLQSDGVSCEDINECITGS HNCRLGESCINTVGSFR


    Database link: D3ZQ25

  • Positive control

    • IHC-P: Rat liver, testis, stomach and pancreas tissues. WB: Rat heart, liver and brain lysates; Recombinant Rat Fibulin 1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab230994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 78 kDa.

Target

  • Function

    Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes. Has been implicated in a role in cellular transformation and tumor invasion, it appears to be a tumor suppressor. May play a role in haemostasis and thrombosis owing to its ability to bind fibrinogen and incorporate into clots. Could play a significant role in modulating the neurotrophic activities of APP, particularly soluble APP.
  • Tissue specificity

    Isoform A and isoform B are only expressed in placenta. Isoform C and isoform D are expressed in a variety of tissues and cultured cells.
  • Involvement in disease

    Note=A chromosomal aberration involving FBLN1 is found in a complex type of synpolydactyly referred to as 3/3-prime/4 synpolydactyly associated with metacarpal and metatarsal synostoses. Reciprocal translocation t(12;22)(p11.2;q13.3) with C12orf2. Fibroblasts derived from a patient with synpolydactyly displayed alterations in the level of isoform D splice variant incorporated into the ECM and secreted into the conditioned culture medium. By contrast, the expression of isoform C was not perturbed in the patients fibroblasts. Furthermore, no aberrant polypeptides were detected in extracts of cultured patients fibroblasts. The translocation t(12;22) may result in haploinsufficiency of the isoform D splice variant, which could lead to the observed limb malformation.
    Note=Elevated expression and altered processing of FBLN1 protein is associated with human breast cancer.
  • Sequence similarities

    Belongs to the fibulin family.
    Contains 3 anaphylatoxin-like domains.
    Contains 9 EGF-like domains.
  • Developmental stage

    Widely expressed during embryonic development. Prominent in the matrix of the leptomeningeal anlage, in basement membranes of the neuroepithelium and the perineurium of peripheral nerves. In embryos of gestational week (gw) 4, staining was observed in the early mesenchymal bone anlagen. In gw 6.5 and 8, all perichondrial structures showed expression but the chondrocytes themselves showed no staining. In gw 10, expression is prominent in the interterritorial matrix surrounding the hypertrophic chondrocytes.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Basement membrane protein 90 antibody
    • BM 90 antibody
    • FBLN antibody
    • Fbln1 antibody
    • FBLN1_HUMAN antibody
    • FIBL 1 antibody
    • FIBL-1 antibody
    • FIBL1 antibody
    • Fibulin 1 antibody
    • Fibulin-1 antibody
    see all

Images

  • Paraffin-embedded rat liver tissue stained for Fibulin 1 using ab230994 at 20 µg/ml in immunohistochemical analysis.

  • All lanes : Anti-Fibulin 1 antibody (ab230994) at 2 µg/ml

    Lane 1 : Rat serum
    Lane 2 : Rat heart lysate
    Lane 3 : Rat liver lysate
    Lane 4 : Rat brain lysate

    Predicted band size: 78 kDa

  • Paraffin-embedded rat testis tissue stained for Fibulin 1 using ab230994 at 20 µg/ml in immunohistochemical analysis.

  • Paraffin-embedded rat stomach tissue stained for Fibulin 1 using ab230994 at 20 µg/ml in immunohistochemical analysis.

  • Paraffin-embedded rat pancreas tissue stained for Fibulin 1 using ab230994 at 20 µg/ml in immunohistochemical analysis.

  • Anti-Fibulin 1 antibody (ab230994) at 2 µg/ml + Recombinant Rat Fibulin 1 protein

    Predicted band size: 78 kDa

References

ab230994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up