Overview

  • Product name

  • Description

    Rabbit polyclonal to Fibulin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Fibulin 2 aa 301-440.
    Sequence:

    HRGLDGLPTTAPAGPSLPIQEERAEAGARAEAGARPEENLILDAQATSRS TGPEGVTHAPSLGKAALVPTQAVPGSPRDPVKPSPHNILSTSLPDAAWIP PTREVPRKPQVLPHSHVEEDTDPNSVHSIPRSSPEGSTKD


    Database link: P98095

  • Positive control

    • WB: HeLa, U-251 MG and A549 whole cell lysates. IHC-P: Human placenta and liver cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 127 kDa (predicted molecular weight: 127 kDa).
IHC-P 1/500 - 1/1000.

Target

  • Function

    Its binding to fibronectin and some other ligands is calcium dependent.
  • Tissue specificity

    Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.
  • Sequence similarities

    Belongs to the fibulin family.
    Contains 3 anaphylatoxin-like domains.
    Contains 11 EGF-like domains.
  • Developmental stage

    Widely expressed during embryonic development. Primarily detected within the neuropithelium, spinal ganglia and peripheral nerves.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Fbln2 antibody
    • FBLN2_HUMAN antibody
    • FIBL-2 antibody
    • Fibulin-2 antibody
    • OTTHUMP00000216670 antibody
    • OTTHUMP00000216671 antibody
    • OTTHUMP00000216672 antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for Fibulin 2 using ab234993 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • All lanes : Anti-Fibulin 2 antibody (ab234993) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 127 kDa
    Observed band size: 127 kDa

  • Paraffin-embedded human liver cancer tissue stained for Fibulin 2 using ab234993 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab234993 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up