Overview

  • Product name

  • Description

    Rabbit polyclonal to Fibulin-4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chinese hamster
  • Immunogen

    Recombinant fragment corresponding to Human Fibulin-4 aa 26-165.
    Sequence:

    SPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHY GGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVD ECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDI


    Database link: O95967

  • Positive control

    • IHC-P: Human placenta tissue. WB: Mouse lung tissue lysate.
  • General notes

     This product was previously labelled as EFEMP2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Involvement in disease

    Defects in EFEMP2 are a cause of cutis laxa autosomal recessive type 1 (ARCL1) [MIM:219100]. Hereditary cutis laxa refers to a heterogeneous group of connective tissue disorders characterized by cutaneous abnormalities and variable systemic manifestations. The most constant clinical feature is loose skin, sagging over the face and trunk. Hereditary cutis laxa is inherited in both autosomal dominant and autosomal recessive modes. ARCL1 shows the most severe phenotype and has the poorest prognosis. In addition to the skin, internal organs enriched in elastic fibers, such as the lung and arteries, are affected.
  • Sequence similarities

    Belongs to the fibulin family.
    Contains 6 EGF-like domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • EFEMP 2 antibody
    • EFEMP2 antibody
    • EGF containing fibulin like extracellular matrix protein 2 antibody
    • EGF-containing fibulin-like extracellular matrix protein 2 antibody
    • FBLN 4 antibody
    • FBLN4 antibody
    • FBLN4_HUMAN antibody
    • FIBL 4 antibody
    • FIBL-4 antibody
    • FIBL4 antibody
    • Fibulin 4 antibody
    • Fibulin-4 antibody
    • MBP 1 antibody
    • MBP1 antibody
    • Mutant p53 binding protein 1 antibody
    • Protein UPH1 antibody
    • UPH 1 antibody
    • UPH1 antibody
    • UPH1 protein antibody
    see all

Images

  • Anti-Fibulin-4 antibody (ab222846) at 1/1000 dilution + Mouse lung tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Observed band size: 50,70 kDa
    why is the actual band size different from the predicted?

  • Paraffin embedded human placenta tissue stained for Fibulin-4 with ab222846 at  1/100 dilution in immunohistochemical analysis.

References

ab222846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up