Overview

  • Product name

    Anti-Fibulin 7 antibody - C-terminal
    See all Fibulin 7 primary antibodies
  • Description

    Rabbit polyclonal to Fibulin 7 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human Fibulin 7 aa 251-300 (C terminal). The exact sequence is proprietary.
    Sequence:

    VMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFV


    Database link: Q53RD9-4

  • Positive control

    • OVCAR 3 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab178022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa.

Target

  • Function

    An adhesion molecule that interacts with extracellular matrix molecules in developing teeth and may play important roles in differentiation and maintenance of odontoblasts as well as in dentin formation.
  • Sequence similarities

    Belongs to the fibulin family.
    Contains 2 EGF-like domains.
    Contains 1 Sushi (CCP/SCR) domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • FBLN7 antibody
    • FBLN7_HUMAN antibody
    • FIBL-7 antibody
    • Fibl7 antibody
    • Fibulin-7 antibody
    • TM14 antibody
    see all

Images

  • Anti-Fibulin 7 antibody - C-terminal (ab178022) at 1 µg/ml + OVCAR 3 whole cell lysate at 10 µg

    Predicted band size: 33 kDa

References

ab178022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up