Overview

  • Product name
    Anti-FIGLA antibody - C-terminal
    See all FIGLA primary antibodies
  • Description
    Rabbit polyclonal to FIGLA - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Mouse FIGLA aa 141-190 (C terminal). The exact sequence is proprietary.
    Sequence:

    SSTRELLGNATQPTSCASGLKKEEEGPWAYAGHSEPLYSYHQSTVPETRS


    Database link: NP_036143

  • Positive control
    • Mouse spleen lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab170973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 mg/ml. Predicted molecular weight: 24 kDa.

Target

  • Function
    Germline specific transcription factor implicated in postnatal oocyte-specific gene expression. Plays a key regulatory role in the expression of multiple oocyte-specific genes, including those that initiate folliculogenesis and those that encode the zona pellucida (ZP1, ZP2 and ZP3) required for fertilization and early embryonic survival. Essential for oocytes to survive and form primordial follicles. The persistence of FIGLA in adult females suggests that it may regulate additional pathways that are essential for normal ovarian development. Binds to the E-box (5'-CANNTG-3') of the ZPs (ZP1, ZP2, ZP3) promoters.
  • Tissue specificity
    Germ cells. Expressed in the fetal ovary, but not by a range of other tissues. Expression increases across mid-gestation, rising some 40-fold by the time of primordial follicle formation.
  • Involvement in disease
    Defects in FIGLA are the cause of premature ovarian failure type 6 (POF6) [MIM:612310]. An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.
  • Sequence similarities
    Contains 1 bHLH (basic helix-loop-helix) domain.
  • Developmental stage
    Expressed in ovarian follicles (from the primordial through to the secondary stage), in mature oocytes, and less frequently in preimplantation embryos.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • bHLHc8 antibody
    • Class C basic helix-loop-helix protein 8 antibody
    • Factor in the germline alpha antibody
    • FIGalpha antibody
    • FIGLA antibody
    • FIGLA_HUMAN antibody
    • Folliculogenesis specific basic helix loop helix antibody
    • Folliculogenesis-specific basic helix-loop-helix protein antibody
    • POF6 antibody
    • Transcription factor FIGa antibody
    see all

Images

  • Anti-FIGLA antibody - C-terminal (ab170973) at 1 µg/ml + Mouse spleen lysate at 10 µg

    Predicted band size: 24 kDa

References

ab170973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up