Overview

  • Product name

    Anti-FIGN/Fidgetin antibody
    See all FIGN/Fidgetin primary antibodies
  • Description

    Rabbit polyclonal to FIGN/Fidgetin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human FIGN/Fidgetin aa 1-308. (Expressed in E.coli).
    Sequence:

    MISSTSVYGLKMQWTPEHAQWPEQHFDITSTTRSPAHKVEAYRGHLQRTY QYAWANDDISALTASNLLKKYAEKYSGILEGPVDRPVLSNYSDTPSGLVN GRKNESEPWQPSLNSEAVYPMNCVPDVITASKAGVSSALPPADVSASIGS SPGVASNLTEPSYSSSTCGSHTVPSLHAGLPSQEYAPGYNGSYLHSTYSS QPAPALPSPHPSPLHSSGLLQPPPPPPPPPALVPGYNGTSNLSSYSYPSA SYPPQTAVGSGYSPGGAPPPPSAYLPSGIPAPTPLPPTTVPGYTYQGHGL TPIAPSAL


    Database link: Q5HY92

  • Positive control

    • WB: HeLa and HEK-293T cell lysates; Recombinant human FIGN/Fidgetin protein. Pig kidney tissue lysate. IHC-P: Human liver tissue.
  • General notes

     This product was previously labelled as FIGN

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 82 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for FIGN/Fidgetin using ab232756 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-FIGN/Fidgetin antibody (ab232756) at 3 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Pig kidney lysate
    Lane 3 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 82 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for FIGN/Fidgetin using ab232756 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-FIGN/Fidgetin antibody (ab232756) at 3 µg/ml + Recombinant human FIGN/Fidgetin protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 82 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for FIGN/Fidgetin using ab232756 at 20 ug/ml in immunohistochemical analysis. DAB staining.

References

ab232756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up