Overview

  • Product name

  • Description

    Rabbit polyclonal to FIGNL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FIGNL1 aa 562-658.
    Sequence:

    RLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQL CREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPK


    Database link: Q6PIW4

  • Positive control

    • Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling FIGNL1 with ab185674 at a 1/200 dilution.

References

ab185674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up