Overview

  • Product name

  • Description

    Rabbit polyclonal to FILGAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FILGAP aa 486-612.
    Sequence:

    ILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNV HQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFG GNFEDPVLDGPPQDDLSHPRDYESKSD


    Database link: Q8N264

  • Positive control

    • IHC-P: Human kidney tissue.
  • General notes

     This product was previously labelled as Rho GTPase-activating protein 24

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    ARHGAP24 is a rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. It acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. It controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. There are five different isoforms.Isoform 1 is widely expressed with a higher level in kidney. Isoform 2 is mainly expressed in endothelial cells and is involved in modulation of angiogenesis.
  • Cellular localization

    Cytoplasmic, cytoskeleton. Cell junction: adherens junction, focal adhesion. Cell projection.
  • Database links

  • Alternative names

    • ARHGAP24 antibody
    • DKFZP564B1162 antibody
    • Filamin A associated RhoGAP antibody
    • FILGAP antibody
    • FLJ33877 antibody
    • p73 antibody
    • p73RhoGAP antibody
    • RAC1 and CDC4 specific GTPase activating protein of 72kDa antibody
    • RCGAP72 antibody
    • Rho GTPase activating protein 24 antibody
    • Rho type GTPase activating protein 24 antibody
    • RhoGAP of 73 kDa antibody
    • Sarcoma antigen NY SAR 88 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for FILGAP using ab224371 at 1/50 dilution in immunohistochemical analysis.

References

ab224371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up