FITC Anti-ENO1 antibody (ab193147)
Key features and details
- FITC Rabbit polyclonal to ENO1
- Reacts with: Mouse
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG
Overview
-
Product name
FITC Anti-ENO1 antibody
See all ENO1 primary antibodies -
Description
FITC Rabbit polyclonal to ENO1 -
Host species
Rabbit -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Species reactivity
Reacts with: Mouse
Predicted to work with: Rat, Chicken, Cow, Human, Xenopus laevis, Cynomolgus monkey, Orangutan
-
Immunogen
Recombinant full length protein corresponding to Mouse ENO1 aa 2-434.
Sequence:SILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRD NDKTRFMGKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTE NKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFN VINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYG KDATNVGDEGGFAPNILENKEALELLKTAIAKAGYTDQVVIGMDVAASEF YRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQDDW GAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVT ESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRS ERLAKYNQILRIEEELGSKAKFAGRSFRNPLAK
Database link: P17182 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 50% PBS, 49% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading... -
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Target
-
Function
Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.
MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor. -
Tissue specificity
The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons. -
Pathway
Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5. -
Sequence similarities
Belongs to the enolase family. -
Developmental stage
During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells. -
Post-translational
modificationsISGylated. -
Cellular localization
Nucleus and Cytoplasm. Cell membrane. Cytoplasm > myofibril > sarcomere > M line. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form. ENO1 is localized to the M line. - Information by UniProt
-
Database links
- Entrez Gene: 396017 Chicken
- Entrez Gene: 281141 Cow
- Entrez Gene: 2023 Human
- Entrez Gene: 100045967 Mouse
- Entrez Gene: 100503183 Mouse
- Entrez Gene: 13806 Mouse
- Entrez Gene: 433182 Mouse
- Entrez Gene: 100173448 Orangutan
see all -
Alternative names
- 2 phospho D glycerate hydro lyase antibody
- 2-phospho-D-glycerate hydro-lyase antibody
- Alpha enolase antibody
see all
References (0)
ab193147 has not yet been referenced specifically in any publications.
