FITC Anti-GFP antibody (ab6662)
Key features and details
- FITC Goat polyclonal to GFP
- Suitable for: IHC-FoFr, IHC-Fr, WB, ICC/IF
- Reacts with: Species independent
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
FITC Anti-GFP antibody
See all GFP primary antibodies -
Description
FITC Goat polyclonal to GFP -
Host species
Goat -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Tested applications
Suitable for: IHC-FoFr, IHC-Fr, WB, ICC/IFmore details -
Species reactivity
Reacts with: Species independent -
Immunogen
Recombinant full length protein corresponding to GFP aa 1-246.
Sequence:MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTT GKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFF KDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNV YIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Database link: P42212 -
Positive control
- WB: Recombinant A. victoria GFP protein.
-
General notes
Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation. Fluorescein conjugated anti-GFP was assayed by immunofluorescence microscopy on prokaryotic (E.coli) and eukaryotic (CHO cells) expression systems and was shown to detect GFP containing inserts. Significant amplification of signal was detected using fluorochrome conjugated anti-GFP relative to the fluorescence of GFP alone.
In case of unexpected background, use pre-adsorbed secondary antibodies.Fluorescein isothiocyanate (FITC) (MW 390 daltons) Absorption Wavelength: 495 nm Emission Wavelength: 528 nm Fluorochrome/Protein Ratio: 3.5 moles FITC per mole of Goat IgG
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.50
Preservative: 0.01% Sodium azide
Constituents: 0.42% Potassium phosphate, 0.87% Sodium chloride, 1% BSA
BSA Immunoglobulin and Protease free -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
GFP Fluorescein Conjugated Antibody was prepared from monospecific antiserum by immunoaffinity chromatography using Green Fluorescent Protein (Aequorea victoria) coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. -
Primary antibody notes
Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation. Fluorescein conjugated anti-GFP was assayed by immunofluorescence microscopy on prokaryotic (E.coli) and eukaryotic (CHO cells) expression systems and was shown to detect GFP containing inserts. Significant amplification of signal was detected using fluorochrome conjugated anti-GFP relative to the fluorescence of GFP alone. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab6662 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-FoFr | (1) |
1/250.
|
IHC-Fr | (5) |
Use at an assay dependent concentration.
|
WB | (1) |
1/10000.
|
ICC/IF | (4) |
1/500 - 1/2500.
|
Notes |
---|
IHC-FoFr
1/250. |
IHC-Fr
Use at an assay dependent concentration. |
WB
1/10000. |
ICC/IF
1/500 - 1/2500. |
Target
-
Relevance
Function: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca2+ -activated photoprotein aequorin.
Subunit structure: Monomer.
Tissue specificity: Photocytes.
Post-translational modification: Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen.
Biotechnological use: Green fluorescent protein has been engineered to produce a vast number of variously colored mutants, fusion proteins, and biosensors. Fluorescent proteins and its mutated allelic forms, blue, cyan and yellow have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. Can also be used as a molecular thermometer, allowing accurate temperature measurements in fluids. The measurement process relies on the detection of the blinking of GFP using fluorescence correlation spectroscopy.
Sequence similarities: Belongs to the GFP family.
Biophysicochemical properties: Absorption: Abs(max)=395 nm
Exhibits a smaller absorbance peak at 470 nm. The fluorescence emission spectrum peaks at 509 nm with a shoulder at 540 nm. -
Alternative names
- GFP antibody
- Green fluorescent protein antibody
Images
-
FITC Anti-GFP antibody (ab6662) +
Recombinant A. victoria GFP protein (ab84191)
Secondary
Fluorescein goat secondary antibody for 60 minutes at RT at 1/1000 dilutionBlock: Blocking buffer for 30 minutes at RT.
-
Oscillation of Cyclin E and E2F target gene expression is deregulated in de2f1b mutant salivary glands.
Salivary glands of control and de2f1b mutant early (80–85 hr AEL) third instar larvae expressing PCNA-GFP (green, ab6662) are stained with anti-dE2F1 (red). The region where high PCNA-GFP is observed with low dE2F1 is marked by an asterisk.
For Immunostaining, third instar imaginal discs and salivary glands were dissected in PBS and immediately fixed in 4% formaldehyde in PBS for 20 minutes at room temperature with the exception of tissues subjected to anti-dE2F1 staining that were fixed for 30 minutes on ice. Fixed tissues were then washed with 0.3% PBST (0.3% TritonX-100 in 1XPBS) and 0.1% PBST (0.1% TritonX-100 in 1XPBS). Samples were incubated with appropriate amount of primary antibody in 0.1% PBST and 1%BSA overnight. Samples were then washed with 0.1% PBST, incubated in secondary antibody in 0.1% PBST and 1% BSA for 2 hours, followed by several washes in 0.1% PBST prior to mounting.
-
ab6662 staining mouse brain tissue sections (inducible GFP reporter) by IHC-Fr.
The tissue was paraformaldehyde fixed and blocked with serum and then incubated with the antibody at a 1/1000 dilution for 1 hour.
Staining is shown in the left hand panel. The middle panel shows staining with a rabbit anti-GFP antibody and the right hand panel shows the merged images (plus DAPI).
ab6662 gives no noticable background and it is found that when viewing on an epifluorescent the exposure time is significantly reduced.
-
Immunofluorescence Microscopy using ab6662.
Tissue: Sf-1:Cre mice crossed to the Z/EG reporter line. Mouse brain (coronal view, 20X magnification).
Fixation: 4% PFA/PBS with o/n fixation, and subsequently transferred to a 30% sucrose solution.
Antigen retrieval: Frozen in OCT freezing medium (Sakura) and cryostat sectioned at 40 microns.
Goat anti-GFP was used at 1/500 dilution in free floating imunnohistochemistry to detect GFP.
Secondary antibody: Fluorchrome conjugated Anti-goat IgG secondary antibody was used for detection at 1:500 at 1/10,000 for 45 minutes at RT.
Localization: Sf-1+ neurons and their processes of the ventromedial nucleus of the hypothalamus.
Staining: eGFP as green fluorescent signal and sections were counterstained with DAPI.
-
These pictures show confocal immunofluorescence using GFP-expressing glial cells (green) transplanted into the lesioned rat spinal cord.
Detected using ab6662 and a standard FITC filter set. Axons are labeled red by an antibody to neurofilament-200 and a rhodamine secondary antibody. The upper panel shows the centre of the transplant site at low power. Numerous GFP-positive cells can be seen mingling with axons. The lower panel shows, at high power in a single optical section, how ab6662 reveals the morphology of the transplanted cells to such an extent that their close interactions with axons are obvious - the cell depicted can be seen wrapping around a neurofilament-200 positive axon.
These images were kindly supplied as part of the review submitted by Andrew Toft.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (171)
ab6662 has been referenced in 171 publications.
- Ríos-Barrera LD & Leptin M An endosome-associated actin network involved in directed apical plasma membrane growth. J Cell Biol 221:N/A (2022). PubMed: 35061016
- Meijer M et al. Epigenomic priming of immune genes implicates oligodendroglia in multiple sclerosis susceptibility. Neuron 110:1193-1210.e13 (2022). PubMed: 35093191
- Rodríguez-Urgellés E et al. Meridianins Rescue Cognitive Deficits, Spine Density and Neuroinflammation in the 5xFAD Model of Alzheimer's Disease. Front Pharmacol 13:791666 (2022). PubMed: 35281935
- Marcogliese PC et al. Drosophila functional screening of de novo variants in autism uncovers damaging variants and facilitates discovery of rare neurodevelopmental diseases. Cell Rep 38:110517 (2022). PubMed: 35294868
- Chen B et al. Identification of macrophages in normal and injured mouse tissues using reporter lines and antibodies. Sci Rep 12:4542 (2022). PubMed: 35296717