FITC Anti-HLA-C antibody - Extracellular domain (ab193417)
Key features and details
- FITC Rabbit polyclonal to HLA-C - Extracellular domain
- Reacts with: Human
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG
Overview
-
Product name
FITC Anti-HLA-C antibody - Extracellular domain
See all HLA-C primary antibodies -
Description
FITC Rabbit polyclonal to HLA-C - Extracellular domain -
Host species
Rabbit -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human HLA-C aa 25-308 (extracellular).
Sequence:CSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAP WVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSG CDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAA RAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEAT LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP SGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPI
Database link: P10321 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
-
Related Products
Target
- Information by UniProt
-
Database links
- Entrez Gene: 3107 Human
- Omim: 142840 Human
- SwissProt: P04222 Human
- SwissProt: P10321 Human
- SwissProt: Q07000 Human
- Unigene: 656020 Human
- Unigene: 743218 Human
- Unigene: 77961 Human
-
Alternative names
- 1C07_HUMAN antibody
- Cw-7 alpha chain antibody
- D6S204 antibody
see all
References (0)
ab193417 has not yet been referenced specifically in any publications.