FITC Anti-NDUFA6 antibody (ab193069)
Key features and details
- FITC Rabbit polyclonal to NDUFA6
- Reacts with: Human
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG
Overview
-
Product name
FITC Anti-NDUFA6 antibody
See all NDUFA6 primary antibodies -
Description
FITC Rabbit polyclonal to NDUFA6 -
Host species
Rabbit -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Chimpanzee, Rhesus monkey, Gorilla
-
Immunogen
Recombinant fragment corresponding to Human NDUFA6 aa 27-154.
Sequence:MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQF QLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQR THVMRFFHETEAPRPKDFLS KFYVGHDP
Database link: P56556 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading... -
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
Target
-
Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. -
Sequence similarities
Belongs to the complex I LYR family. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 458981 Chimpanzee
- Entrez Gene: 327670 Cow
- Entrez Gene: 101135077 Gorilla
- Entrez Gene: 4700 Human
- Entrez Gene: 67130 Mouse
- Omim: 602138 Human
- SwissProt: Q0MQA5 Chimpanzee
- SwissProt: Q02366 Cow
see all -
Alternative names
- B14 antibody
- CI-B14 antibody
- complex I B14 subunit antibody
see all
References (0)
ab193069 has not yet been referenced specifically in any publications.
