FITC Anti-p75 NGF Receptor antibody [8J2] (ab245132)

Submit a review Submit a question
Immunocytochemistry/ Immunofluorescence - FITC Anti-p75 NGF Receptor antibody [8J2] (ab245132)

    Key features and details

    • FITC Mouse monoclonal [8J2] to p75 NGF Receptor
    • Suitable for: ICC/IF
    • Reacts with: Human
    • Conjugation: FITC. Ex: 493nm, Em: 528nm
    • Isotype: IgG2a

    Overview

    • Product name

      FITC Anti-p75 NGF Receptor antibody [8J2]
      See all p75 NGF Receptor primary antibodies

    • Description

      FITC Mouse monoclonal [8J2] to p75 NGF Receptor

    • Host species

      Mouse

    • Conjugation

      FITC. Ex: 493nm, Em: 528nm

    • Tested applications

      Suitable for: ICC/IFmore details

    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat

    • Immunogen

      Recombinant fragment (His-tag) corresponding to Human p75 NGF Receptor aa 29-250 (extracellular).
      Sequence:

      KEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVS ATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVC EAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLR ECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTV AGVVTTVMGSSQPVVTRGTTDN


      Database link: P08138
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • Positive control

      • ICC/IF: SH-SY5Y cells.

    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    Associated products

    Applications

    Our Abpromise guarantee covers the use of ab245132 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    ICC/IF Use a concentration of 1 - 5 µg/ml.

    Light fixation only or unfixed works best. Epitope is sensitive to fixation.

    Target

    • Function

      Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells.

    • Sequence similarities

      Contains 1 death domain.
      Contains 4 TNFR-Cys repeats.

    • Domain

      Death domain is responsible for interaction with RANBP9.
      The extracellular domain is responsible for interaction with NTRK1.

    • Post-translational
      modifications

      N- and O-glycosylated.
      O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc.
      Phosphorylated on serine residues.

    • Cellular localization

      Membrane.
    • Information by UniProt

    • Database links

      see all

    • Alternative names

      • CD271 antibody
      • CD271 antigen antibody
      • Gp80 LNGFR antibody
      • Gp80-LNGFR antibody
      • Low affinity nerve growth factor receptor antibody
      • Low affinity neurotrophin receptor p75NTR antibody
      • Low-affinity nerve growth factor receptor antibody
      • Nerve growth factor receptor antibody
      • Nerve growth factor receptor TNFR superfamily member 16 antibody
      • NGF receptor antibody
      • Ngfr antibody
      • p75 ICD antibody
      • p75 Neurotrophin receptor antibody
      • p75 NTR antibody
      • p75(NTR) antibody
      • p75NTR antibody
      • TNFR Superfamily Member 16 antibody
      • TNFRSF16 antibody
      • TNR16_HUMAN antibody
      • Tumor necrosis factor receptor superfamily member 16 antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - FITC Anti-p75 NGF Receptor antibody [8J2] (ab245132)
      Immunocytochemistry/ Immunofluorescence - FITC Anti-p75 NGF Receptor antibody [8J2] (ab245132)

      SH-SY5Y (human neuroblastoma cell line from bone marrow) cells labeling p75 NGF Receptor using ab245132 at 2 µg/ml (green) in ICC/IF.

      Left panel: Brightfield.

      Middle panel: FITC.

      Right panel: Merged image.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab245132? Please let us know so that we can cite the reference in this datasheet.

    ab245132 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab245132.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com