FITC Anti-Rabies Virus Glycoprotein antibody (ab193407)
Key features and details
- FITC Rabbit polyclonal to Rabies Virus Glycoprotein
- Suitable for: ELISA
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG
Overview
-
Product name
FITC Anti-Rabies Virus Glycoprotein antibody
See all Rabies Virus Glycoprotein primary antibodies -
Description
FITC Rabbit polyclonal to Rabies Virus Glycoprotein -
Host species
Rabbit -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Tested applications
Suitable for: ELISAmore details -
Species reactivity
Reacts with: Other species -
Immunogen
Recombinant fragment corresponding to Rabies Virus Glycoprotein aa 20-459.
Sequence:KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGY ILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNW KMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLH SRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRA SKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETK WCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRR LSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGR CHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLA DPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY
Database link: P03524 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
>95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab193407 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ELISA | Use at an assay dependent concentration. |
Target
-
Relevance
The rabies virus is neurotrophic virus that causes fatal disease in human and animals. Rabies transmission can occur through the saliva of animals. It has a cylindrical morophology and is the type species of the Lyssavirus genus of the Rhabdoviridae family. These viruses are enveloped and have a single stranded RNA genome with negative-sense. The rabies virus is a member of the Lyssavirus genus. This genus of RNA viruses also includes the Aravan virus, Australian bat lyssavirus, Duvenhage virus, European bat lyssavirus 1, European bat lyssavirus 2, Irkut virus, Khujand virus, Lagos bat virus, Mokola virus and the West Caucasian bat virus. Together with the Vesiculovirus and others they form the Rhabdoviridae family. -
Cellular localization
Virion membrane; Single-pass type I membrane protein -
Alternative names
- Glycoprotein G antibody
References (0)
ab193407 has not yet been referenced specifically in any publications.