FITC Anti-RPIA/PRI antibody (ab193545)
Key features and details
- FITC Rabbit polyclonal to RPIA/PRI
- Reacts with: Escherichia coli
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG
Overview
-
Product name
FITC Anti-RPIA/PRI antibody
See all RPIA/PRI primary antibodies -
Description
FITC Rabbit polyclonal to RPIA/PRI -
Host species
Rabbit -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Species reactivity
Reacts with: Escherichia coli -
Immunogen
Recombinant full length protein corresponding to Escherichia coli RPIA/PRI aa 1-219.
Sequence:MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAV SSSDASTEKLKSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAAL TREKIIASVAEKFICIADASKQVDILGKFPLPVEVIPMARSAVARQLVKL GGRPEYRQGVVTDNGNVILDVHGMEILDPIAMENAINAIPGVVTVGLFAN RGADVALIGTPDGVKTIVK
Database link: P0A7ZO -
General notes
This product was previously labelled as RPIA
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading... -
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Target
-
Pathway
Carbohydrate degradation; pentose phosphate pathway; D-ribose 5-phosphate from D-ribulose 5-phosphate (non-oxidative stage): step 1/1. -
Involvement in disease
Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency (RPID) [MIM:608611]. A patient has been described with a deficiency of ribose 5-phosphate isomerase who presented with leukoencephalopathy and peripheral neuropathy. Proton magnetic resonance spectroscopy of the brain revealed a highly elevated level of the polyols ribitol and D-arabitol, which were subsequently also found in high concentrations in body fluids. Deficient activity of RPIA, one of the pentose phosphate pathway enzymes, has been demonstrated in fibroblasts. -
Sequence similarities
Belongs to the ribose 5-phosphate isomerase family. - Information by UniProt
-
Database links
- Entrez Gene: 947407 Escherichia coli
- SwissProt: P0A7Z0 Escherichia coli
-
Alternative names
- EC 5.3.1.6 antibody
- MGC103524 antibody
- Phosphoriboisomerase A antibody
see all
References (0)
ab193545 has not yet been referenced specifically in any publications.
