FITC Anti-TB Ag85A antibody (ab193480)
Key features and details
- FITC Rabbit polyclonal to TB Ag85A
- Suitable for: WB
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG
Overview
-
Product name
FITC Anti-TB Ag85A antibody
See all TB Ag85A primary antibodies -
Description
FITC Rabbit polyclonal to TB Ag85A -
Host species
Rabbit -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Specificity
Reacts with Mycobacterium tuberculosis. -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Other species -
Immunogen
Recombinant fragment corresponding to TB Ag85A aa 53-331. Mycobacterium tuberculosis.
Sequence:YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFE WYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWL QANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAM GPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWV YCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDS GTHSWEYWGAQLNAMKPDLQRALGATPNT
Database link: P9WQP2 -
Positive control
- Recombinant Mycobacterium tuberculosis TB Ag85A protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab193480 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 2 µg/ml. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa). |
Target
-
Relevance
Mycobacterium tuberculosis antigen 85 is a complex of three related gene products of 30-31 kDa, Ag85A, B and C. These proteins are responsible for the high affinity of mycobacteria to fibronectin. All three proteins possesses a mycolyltransferase activity - which is required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity. Thus all three proteins are involved in the final stages of mycobacterial cell wall assembly. -
Cellular localization
Secreted; cell wall. Cytoplasm -
Alternative names
- 85 A antibody
- 85A antibody
- Ag85A antibody
see all
Images
-
All lanes : FITC Anti-TB Ag85A antibody (ab193480) at 2 µg/ml
Lane 1 : Recombinant Mycobacterium tuberculosis TB Ag85A protein at 1 µg
Lane 2 : Recombinant Mycobacterium tuberculosis TB Ag85A protein at 10 µg
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 36 kDa
Observed band size: 36 kDa
References (0)
ab193480 has not yet been referenced specifically in any publications.