FITC Anti-TCR V beta 3.1 antibody [8F10], prediluted (ab171112)

Submit a review Submit a question
Flow Cytometry - FITC Anti-TCR V beta 3.1 antibody [8F10], prediluted (ab171112)

    Key features and details

    • FITC Mouse monoclonal [8F10] to TCR V beta 3.1, prediluted
    • Suitable for: Flow Cyt
    • Reacts with: Human, Non human primates
    • Conjugation: FITC. Ex: 493nm, Em: 528nm
    • Isotype: IgG1

    Overview

    • Product name

      FITC Anti-TCR V beta 3.1 antibody [8F10], prediluted
      See all TCR V beta 3.1 primary antibodies

    • Description

      FITC Mouse monoclonal [8F10] to TCR V beta 3.1, prediluted

    • Host species

      Mouse

    • Conjugation

      FITC. Ex: 493nm, Em: 528nm

    • Tested applications

      Suitable for: Flow Cytmore details

    • Species reactivity

      Reacts with: Human, Non human primates

    • Immunogen

      Recombinant full length protein corresponding to Human TCR V beta 3.1 aa 1-133.
      Sequence:

      MGTSLLCWMALCLLGADHADTGVSQNPRHNITKRGQNVTFRCDPISEHNR LYWYRQTLGQ GPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEI QRTEQGDSAMYLCASSLAGLNQPQHFGDGTRLSIL


      Database link: P04435
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    Associated products

    Applications

    Our Abpromise guarantee covers the use of ab171112 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    Flow Cyt Use a concentration of 200 µg/ml.

    ab91356 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

     

    Target

    Images

    • Flow Cytometry - FITC Anti-TCR V beta 3.1 antibody [8F10], prediluted (ab171112)
      Flow Cytometry - FITC Anti-TCR V beta 3.1 antibody [8F10], prediluted (ab171112)

      Flow cytometry analysis of TCR V beta 3.1 in PBMC cells compared to an isotype control (blue). Human blood was collected, combined with a hydrophilic polysaccharide, centrifuged, transferred to a conical tube and washed with PBS. 50 ul of cell solution was added to each tube at a dilution of 2x10^7 cells/ml, followed by the addition of 50 ul of isotype control and primary antibody (ab171112) at a dilution of 1:20. Cells were incubated for 30 min at 4ºC and washed with a cell buffer, followed by incubation with a DyLight 488-conjugated goat anti-mouse IgG (H+L) secondary for 30 min at 4ºC in the dark. FACS analysis was performed using 400 ul of cell buffer.

    References (0)

    Publishing research using ab171112? Please let us know so that we can cite the reference in this datasheet.

    ab171112 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab171112.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com