FITC Anti-TLR9 antibody [ABM4D70] (ab210925)
Key features and details
- FITC Rat monoclonal [ABM4D70] to TLR9
- Suitable for: Flow Cyt
- Reacts with: Mouse
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG2a
Overview
-
Product name
FITC Anti-TLR9 antibody [ABM4D70]
See all TLR9 primary antibodies -
Description
FITC Rat monoclonal [ABM4D70] to TLR9 -
Host species
Rat -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Mouse -
Immunogen
Recombinant fragment corresponding to Mouse TLR9 aa 602-860.
Sequence:RFLDFSGNGMGRMWDEGGLYLHFFQGLSGLLKLDLSQNNLHILRPQNLDN LPKSLKLLSLRDNYLSFFNWTSLSFLPNLEVLDLAGNQLKALTNGTLPNG TLLQKLDVSSNSIVSVVPAFFALAVELKEVNLSHNILKTVDRSWFGPIVM NLTVLDVRSNPLHCACGAAFVDLLLEVQTKVPGLANGVKCGSPGQLQGRS IFAQDLRLCLDEVLSWDCFGLSLLAVAVGMVVPILHHLCGWDVWYCFHLC LAWLPLLAR
Database link: Q9EQU3 -
Positive control
- Mouse splenocytes.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 99% PBS, 0.05% BSA -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
ABM4D70 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab210925 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt | Use 0.25µg for 106 cells. |
Target
-
Function
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. -
Tissue specificity
Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver. -
Sequence similarities
Belongs to the Toll-like receptor family.
Contains 26 LRR (leucine-rich) repeats.
Contains 1 TIR domain. -
Cellular localization
Endoplasmic reticulum membrane. Endosome. Lysosome. Cytoplasmic vesicle > phagosome. Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist. - Information by UniProt
-
Database links
- Entrez Gene: 81897 Mouse
- SwissProt: Q9EQU3 Mouse
- Unigene: 44889 Mouse
-
Alternative names
- CD 289 antibody
- CD289 antibody
- TLR 9 antibody
see all
Images
Datasheets and documents
References (0)
ab210925 has not yet been referenced specifically in any publications.