FITC Anti-TLR9 antibody [ABM4D70] (ab210925)

Submit a review Submit a question
Flow Cytometry - FITC Anti-TLR9 antibody [ABM4D70] (ab210925)

    Key features and details

    • FITC Rat monoclonal [ABM4D70] to TLR9
    • Suitable for: Flow Cyt
    • Reacts with: Mouse
    • Conjugation: FITC. Ex: 493nm, Em: 528nm
    • Isotype: IgG2a

    Overview

    • Product name

      FITC Anti-TLR9 antibody [ABM4D70]
      See all TLR9 primary antibodies

    • Description

      FITC Rat monoclonal [ABM4D70] to TLR9

    • Host species

      Rat

    • Conjugation

      FITC. Ex: 493nm, Em: 528nm

    • Tested applications

      Suitable for: Flow Cytmore details

    • Species reactivity

      Reacts with: Mouse

    • Immunogen

      Recombinant fragment corresponding to Mouse TLR9 aa 602-860.
      Sequence:

      RFLDFSGNGMGRMWDEGGLYLHFFQGLSGLLKLDLSQNNLHILRPQNLDN LPKSLKLLSLRDNYLSFFNWTSLSFLPNLEVLDLAGNQLKALTNGTLPNG TLLQKLDVSSNSIVSVVPAFFALAVELKEVNLSHNILKTVDRSWFGPIVM NLTVLDVRSNPLHCACGAAFVDLLLEVQTKVPGLANGVKCGSPGQLQGRS IFAQDLRLCLDEVLSWDCFGLSLLAVAVGMVVPILHHLCGWDVWYCFHLC LAWLPLLAR


      Database link: Q9EQU3
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • Positive control

      • Mouse splenocytes.

    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    Applications

    Our Abpromise guarantee covers the use of ab210925 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    Flow Cyt Use 0.25µg for 106 cells.

    Target

    • Function

      Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

    • Tissue specificity

      Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver.

    • Sequence similarities

      Belongs to the Toll-like receptor family.
      Contains 26 LRR (leucine-rich) repeats.
      Contains 1 TIR domain.

    • Cellular localization

      Endoplasmic reticulum membrane. Endosome. Lysosome. Cytoplasmic vesicle > phagosome. Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist.
    • Information by UniProt

    • Database links

      • Alternative names

        • CD 289 antibody
        • CD289 antibody
        • TLR 9 antibody
        • TLR9 antibody
        • TLR9_HUMAN antibody
        • Toll like receptor 9 antibody
        • Toll like receptor 9 isoform A precursor antibody
        • Toll like receptor 9 isoform B antibody
        • Toll-like receptor 9 antibody
        see all

      Images

      • Flow Cytometry - FITC Anti-TLR9 antibody [ABM4D70] (ab210925)
        Flow Cytometry - FITC Anti-TLR9 antibody [ABM4D70] (ab210925)

        Flow cytometric analysis of mouse splenocytes labeling TLR9 with ab210925 at 0.25 µg/106 cells (red) compared with negative control cells (green). FITC-conjugated secondary antibodies were used for the analysis.

      References (0)

      Publishing research using ab210925? Please let us know so that we can cite the reference in this datasheet.

      ab210925 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab210925.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com