Overview

  • Product name

  • Description

    Rabbit polyclonal to FKBP11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human FKBP11 aa 28-154.
    Sequence:

    GLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTS LTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPS VPADAVVQYDVELIALIRANYWLKLVK


    Database link: Q9NYL4-1

  • Positive control

    • WB: Mouse liver and spleen tissue lysate. IHC-P: Human gastric cancer and pancreas tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab237528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    PPIases accelerate the folding of proteins during protein synthesis.
  • Sequence similarities

    Belongs to the FKBP-type PPIase family.
    Contains 1 PPIase FKBP-type domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 19 kDa FK506 binding protein antibody
    • 19 kDa FK506-binding protein antibody
    • 19 kDa FKBP antibody
    • FK506 binding protein 11 (19 kDa) antibody
    • FK506 binding protein 11 antibody
    • FK506-binding protein 11 antibody
    • FKB11_HUMAN antibody
    • FKBP 19 antibody
    • FKBP-11 antibody
    • FKBP-19 antibody
    • Fkbp11 antibody
    • FKBP19 antibody
    • MGC54182 antibody
    • Peptidyl prolyl cis trans isomerase antibody
    • Peptidyl-prolyl cis-trans isomerase FKBP11 antibody
    • PPIase antibody
    • PPIase FKBP11 antibody
    • Rotamase antibody
    see all

Images

  • All lanes : Anti-FKBP11 antibody (ab237528) at 1/500 dilution

    Lane 1 : Mouse spleen tissue lysate
    Lane 2 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 22 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for FKBP11 using ab237528 at a dilution of 1/100 in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human gastric cancer tissue stained for FKBP11 with ab237528 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for FKBP11 with ab237528 at 1/100 dilution in immunohistochemical analysis.

References

ab237528 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237528.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up