Anti-FKBP12 antibody (ab180758)
Key features and details
- Rabbit polyclonal to FKBP12
- Suitable for: WB
- Reacts with: Mouse
- Isotype: IgG
Overview
-
Product name
Anti-FKBP12 antibody
See all FKBP12 primary antibodies -
Description
Rabbit polyclonal to FKBP12 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse -
Immunogen
Recombinant full length protein corresponding to Human FKBP12 aa 1-108.
Sequence:MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFM LGKQEVIRGWE EGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATL VFDVELLKLE
Database link: P62942 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180758 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 12 kDa.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 12 kDa. |
Target
-
Function
May play a role in modulation of ryanodine receptor isoform-1 (RYR-1), a component of the calcium release channel of skeletal muscle sarcoplasmic reticulum. There are four molecules of FKBP12 per skeletal muscle RYR. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. -
Sequence similarities
Belongs to the FKBP-type PPIase family. FKBP1 subfamily.
Contains 1 PPIase FKBP-type domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 14225 Mouse
- SwissProt: P26883 Mouse
- Unigene: 278458 Mouse
- Unigene: 381214 Mouse
-
Alternative names
- 12 kDa FK506-binding protein antibody
- 12 kDa FKBP antibody
- Calstabin 1 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab180758 has not yet been referenced specifically in any publications.