Overview

  • Product name

  • Description

    Rabbit polyclonal to FKBP135
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human FKBP135 aa 542-663.
    Sequence:

    KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQ NDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKV TEELAAATAQVSHLQLKMTAHQ


    Database link: Q5T1M5

  • Positive control

    • WB: RT4 cell lysate. IHC-P: Human adrenal gland tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 134 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in the cytoskeletal organization of neuronal growth cones. Seems to be inactive as a PPIase (By similarity). Involved in the transport of early endosomes at the level of transition between microfilament-based and microtubule-based movement.
  • Sequence similarities

    Belongs to the FKBP-type PPIase family.
    Contains 1 PPIase FKBP-type domain.
  • Domain

    The PPIase FKBP-type domain seems to be inactive both for FK506-binding and enzymatic activity.
    The central coiled-coil region is responsible for association with early endosomes.
  • Cellular localization

    Cytoplasm. Cell projection > axon. Early endosome. Present in axons and neuronal growth cones.
  • Information by UniProt
  • Database links

  • Alternative names

    • 133 kDa FK506-binding protein antibody
    • 133 kDa FKBP antibody
    • C430014M02Rik antibody
    • FK506 binding protein 135 antibody
    • FK506-binding protein 15 antibody
    • FKB15_HUMAN antibody
    • FKBO133 antibody
    • FKBP-133 antibody
    • FKBP-15 antibody
    • FKBP133 antibody
    • Fkbp15 antibody
    • KIAA0674 antibody
    • mKIAA0674 antibody
    • Peptidyl prolyl cis trans isomerase antibody
    • RIKEN cDNA C430014M02 gene antibody
    • RP23 64F17.7 antibody
    • WAFL antibody
    • WASP and FKBP-like antibody
    see all

Images

  • Paraffin embedded human adrenal gland tissue stained for FKBP135 with ab224074 (1/20 dilution) in immunohistochemical analysis.

  • Anti-FKBP135 antibody (ab224074) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 134 kDa

References

ab224074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up