Overview

  • Product name

    Anti-FKBP2 antibody
  • Description

    Rabbit polyclonal to FKBP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to FKBP2 aa 22-142. Full length mature protein without the signal peptide.
    Sequence:

    ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLP QNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKI PGGATLVFEVELLKIERRTEL


    Database link: P26885

  • Positive control

    • IHC-P: Human placenta tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificity

    T-cells and thymus.
  • Sequence similarities

    Belongs to the FKBP-type PPIase family. FKBP2 subfamily.
    Contains 1 PPIase FKBP-type domain.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 13 kDa FK506-binding protein antibody
    • 13 kDa FKBP antibody
    • EC 5.2.1.8 antibody
    • FK506 binding protein 2 (13kD) antibody
    • FK506 binding protein 2 13kDa antibody
    • FK506-binding protein 2 antibody
    • FK506-binding protein, T-cell, 13-KD antibody
    • FKBP 13 antibody
    • FKBP 2 antibody
    • FKBP-13 antibody
    • FKBP-2 antibody
    • FKBP13 antibody
    • FKBP2 antibody
    • FKBP2_HUMAN antibody
    • Immunophilin FKBP13 antibody
    • Peptidyl prolyl cis trans isomerase antibody
    • Peptidyl-prolyl cis-trans isomerase FKBP2 antibody
    • PPIase antibody
    • PPIase FKBP2 antibody
    • Proline isomerase antibody
    • Rapamycin binding protein antibody
    • Rotamase antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for FKBP2 using ab238504 at 1/100 dilution in immunohistochemical analysis.

References

ab238504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up